• Gene id: 145957

Gene Summary

• Gene Symbol: NRG4   Gene   UCSC   Ensembl
• Aliases: HRG4
• Gene name: neuregulin 4
• Alternate names: pro-neuregulin-4, membrane-bound isoform, heregulin 4, pro-NRG4,
• Gene location: 15q24.2 (76069829: 75933218)     Exons: 14     NC_000015.10
• Gene summary(Entrez): The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation (Harari et al., 1999 [PubMed 10348342]).[supplied by OMIM, Mar 2008]
• OMIM: 610894

Protein Summary

• Protein general information: Q8WWG1  
  • Name: Pro neuregulin 4, membrane bound isoform (Pro NRG4) [Cleaved into: Neuregulin 4 (NRG 4)]
  • Length: 115  
  • Mass: 12722
• Sequence:

  MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLI
  IGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH

• Structural information:
  • Protein Domains: (5..4-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR013032  IPR000742  IPR040180  
  • Prosite: PS00022 PS50026
  • STRING: ENSP00000378367
• Other Databases: GeneCards:  NRG4  Malacards:  NRG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048513	animal organ development	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:2000145	regulation of cell motility	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04012	ErbB signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)