• Gene id: 1459

Gene Summary

• Gene Symbol: CSNK2A2   Gene   UCSC   Ensembl
• Aliases: CK2A2, CK2alpha', CSNK2A1
• Gene name: casein kinase 2 alpha 2
• Alternate names: casein kinase II subunit alpha', CK II alpha', casein kinase 2 alpha', casein kinase 2, alpha prime polypeptide,
• Gene location: 16q21 (58197919: 58157902)     Exons: 13     NC_000016.10
• Gene summary(Entrez): This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular pr
• OMIM: 115442

SNPs

rs16959755

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.58168185T>A
NC_000016.10   g.58168185T>C
NC_000016.9   g.58202089T>A
NC_000016.9   g.58202089T>C|SEQ=[T/A/C]|GENE=CSNK2A2

rs2242444

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.58165766C>T
NC_000016.9   g.58199670C>T|SEQ=[C/T]|GENE=CSNK2A2

rs2242445

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.58165299G>A
NC_000016.10   g.58165299G>T
NC_000016.9   g.58199203G>A
NC_000016.9   g.58199203G>T|SEQ=[G/A/T]|GENE=CSNK2A2

Protein Summary

• Protein general information: P19784  
  • Name: Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)
  • Length: 350  
  • Mass: 41,213
• Sequence:

  MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVK
  KKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHS
  KGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLAS
  MIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
  LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Structural information:
  • Protein Domains: Protein (40-325)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 3E3B 3OFM 3U87 5M4U 5M56 5OOI
  • PDBsum: 3E3B 3OFM 3U87 5M4U 5M56 5OOI
  • DIP: 318
  • STRING: ENSP00000262506
• Other Databases: GeneCards:  CSNK2A2  Malacards:  CSNK2A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006457	protein folding	TAS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0071174	mitotic spindle checkpoint	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1903146	regulation of mitophagy	IMP	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	IMP	biological process
GO:0031519	PcG protein complex	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006457	protein folding	TAS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0071174	mitotic spindle checkpoint	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1903146	regulation of mitophagy	IMP	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	IMP	biological process
GO:0031519	PcG protein complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0071174	mitotic spindle checkpoint	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1903146	regulation of mitophagy	IMP	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	IMP	biological process
GO:0031519	PcG protein complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal
hsa04520	Adherens junction
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05162	Measles

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 17903301
Globozoospermia	MIK: 15746197
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Globozoospermia	MIK: 15746197
Globozoospermia, male infertility	MIK: 16551740
Role in acrosome biogenesis, Male infertility	MIK: 19258705
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15746197	Globozoospermia			16 (six patients with globozoospermia, 10 fertile controls)	Male infertility	Csnk2a2 Csnk2b
16551740	Globozoospermia, male infertility	Hrb (19081 A DEL, 39 T/C: V139A, 751 T/C (rs7588620), 38 A/G: T472T (rs13426422), 538 A/G (rs13382948)), Csnk2a2 (509 A/G (rs16959755), 839 T/C, 919 A/G (rs2242444), 410 C/A (rs2242445)), GOPC (509 A/G, 531 T/G, 556 C/T, 445 G/A, 612 G/A)		10 (Family1: 1 primary infertility, I globozoospermia, 5 fertile, Family 2: 1 primary infertility, I globozoospermia, 1 fertile)	Male infertility	Hrb GOPC Csnk2a2
19258705	Role in acrosome biogenesis, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray