• Gene id: 1457

Gene Summary

• Gene Symbol: CSNK2A1   Gene   UCSC   Ensembl
• Aliases: CK2A1, CKII, Cka1, Cka2, OCNDS
• Gene name: casein kinase 2 alpha 1
• Alternate names: casein kinase II subunit alpha, CK2 catalytic subunit alpha, casein kinase 2, alpha 1 polypeptide, casein kinase II alpha 1 polypeptide pseudogene, casein kinase II alpha 1 subunit, protein kinase CK2,
• Gene location: 20p13 (543789: 472497)     Exons: 5     NC_000020.11
• Gene summary(Entrez): Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is c
• OMIM: 115440

Protein Summary

• Protein general information: P68400  
  • Name: Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)
  • Length: 391  
  • Mass: 45144
  • Tissue specificity: Expressed in gastric carcinoma tissue and the expression gradually increases with the progression of the carcinoma (at protein level). {ECO
• Sequence:

  MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKK
  KKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSM
  GIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASM
  IFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
  LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAA
  ANPLGMPVPAAAGAQQ

• Structural information:
  • Protein Domains: (39..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1JWH 1NA7 1PJK 2PVR 2ZJW 3AMY 3AT2 3AT3 3AT4 3AXW 3BQC 3C13 3FWQ 3H30 3JUH 3MB6 3MB7 3NGA 3NSZ 3OWJ 3OWK 3OWL 3PE1 3PE2 3PE4 3Q04 3Q9W 3Q9X 3Q9Y 3Q9Z 3QA0 3R0T 3RPS 3TAX 3U4U 3U87 3U9C 3W8L 3WAR 3WIK 3WIL 3WOW 4DGL 4FBX 4GRB 4GUB 4GYW 4GYY 4GZ3 4IB5 4KWP 4MD7 4MD8 4MD9 4NH1 4RLL 4UB7 4UBA 5B0X 5CLP 5CQU 5CQW 5CS6 5CS
  • PDBsum: 1JWH 1NA7 1PJK 2PVR 2ZJW 3AMY 3AT2 3AT3 3AT4 3AXW 3BQC 3C13 3FWQ 3H30 3JUH 3MB6 3MB7 3NGA 3NSZ 3OWJ 3OWK 3OWL 3PE1 3PE2 3PE4 3Q04 3Q9W 3Q9X 3Q9Y 3Q9Z 3QA0 3R0T 3RPS 3TAX 3U4U 3U87 3U9C 3W8L 3WAR 3WIK 3WIL 3WOW 4DGL 4FBX 4GRB 4GUB 4GYW 4GYY 4GZ3 4IB5 4KWP 4MD7 4MD8 4MD9 4NH1 4RLL 4UB7 4UBA 5B0X 5CLP 5CQU 5CQW 5CS6 5CS
  • DIP: 32682
  • STRING: ENSP00000217244
• Other Databases: GeneCards:  CSNK2A1  Malacards:  CSNK2A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IGI	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process	IGI	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0016301	kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005956	protein kinase CK2 complex	IBA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0031519	PcG protein complex	IDA	colocalizes with
GO:0030307	positive regulation of cell growth	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0061077	chaperone-mediated protein folding	TAS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:1905818	regulation of chromosome separation	IMP	biological process
GO:0051879	Hsp90 protein binding	TAS	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0016236	macroautophagy	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006656	phosphatidylcholine biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005956	protein kinase CK2 complex	IDA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04310	Wnt signaling pathway
hsa05162	Measles
hsa04064	NF-kappa B signaling pathway
hsa03008	Ribosome biogenesis in eukaryotes
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04137	Mitophagy - animal
hsa04520	Adherens junction

Diseases

Associated diseases	References
Breast cancer	PMID:11827167
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881