• Gene id: 145482

Gene Summary

• Gene Symbol: PTGR2   Gene   UCSC   Ensembl
• Aliases: HEL-S-298, PGR2, ZADH1
• Gene name: prostaglandin reductase 2
• Alternate names: prostaglandin reductase 2, 15-oxoprostaglandin 13-reductase, 15-oxoprostaglandin-delta13-reductase, PRG-2, epididymis secretory protein Li 298, epididymis secretory sperm binding protein, zinc binding alcohol dehydrogenase, domain containing 1, zinc-binding alco,
• Gene location: 14q24.3 (73851830: 73885725)     Exons: 13     NC_000014.9
• Gene summary(Entrez): This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating a
• OMIM: 608642

Protein Summary

• Protein general information: Q8N8N7  
  • Name: Prostaglandin reductase 2 (PRG 2) (EC 1.3.1.48) (15 oxoprostaglandin 13 reductase) (Zinc binding alcohol dehydrogenase domain containing protein 1)
  • Length: 351  
  • Mass: 38499
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQLSQVVD
  GGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHI
  TAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKKDNVAEQLRESCPAGV
  DVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYKDKFEPGI
  LQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEISL

• Structural information:
  • Interpro: IPR013149  IPR041694  IPR011032  IPR036291  IPR037399  
  • CDD: cd08293
  • PDB: 2VNA 2W4Q 2W98 2ZB4 2ZB7 2ZB8
  • PDBsum: 2VNA 2W4Q 2W98 2ZB4 2ZB7 2ZB8
  • STRING: ENSP00000452280
• Other Databases: GeneCards:  PTGR2  Malacards:  PTGR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006693	prostaglandin metabolic process	IBA	biological process
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IBA	molecular function
GO:0008270	zinc ion binding	IDA	NOT|molecular function
GO:0006693	prostaglandin metabolic process	IDA	biological process
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IDA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IEA	molecular function
GO:0036132	13-prostaglandin reductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881