• Gene id: 145389

Gene Summary

• Gene Symbol: SLC38A6   Gene   UCSC   Ensembl
• Aliases: NAT-1, SNAT6
• Gene name: solute carrier family 38 member 6
• Alternate names: probable sodium-coupled neutral amino acid transporter 6, N system amino acid transporter NAT-1, N-system amino acid transporter 1, Na(+)-coupled neutral amino acid transporter 6,
• Gene location: 14q23.1 (60981113: 61083732)     Exons: 26     NC_000014.9
• OMIM: 616518

Protein Summary

• Protein general information: Q8IZM9  
  • Name: Probable sodium coupled neutral amino acid transporter 6 (N system amino acid transporter 1) (NAT 1) (Na(+) coupled neutral amino acid transporter 6) (Solute carrier family 38 member 6)
  • Length: 456  
  • Mass: 50929
• Sequence:

  MEASWGSFNAERGWYVSVQQPEEAEAEELSPLLSNELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGV
  FGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAA
  IAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYV
  EKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISA
  LFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITL
  ALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALII
  FDWINK

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000346959
• Other Databases: GeneCards:  SLC38A6  Malacards:  SLC38A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015186	L-glutamine transmembrane transporter activity	IBA	molecular function
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0006868	glutamine transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0006865	amino acid transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R