• Gene id: 1453

Gene Summary

• Gene Symbol: CSNK1D   Gene   UCSC   Ensembl
• Aliases: ASPS, CKI-delta, CKId, CKIdelta, FASPS2, HCKID
• Gene name: casein kinase 1 delta
• Alternate names: casein kinase I isoform delta, casein kinase I, tau-protein kinase CSNK1D,
• Gene location: 17q25.3 (82273749: 82239018)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein may also be involved in the regulation of apop
• OMIM: 600864

Protein Summary

• Protein general information: P48730  
  • Name: Casein kinase I isoform delta (CKI delta) (CKId) (EC 2.7.11.1) (Tau protein kinase CSNK1D) (EC 2.7.11.26)
  • Length: 415  
  • Mass: 47330
  • Tissue specificity: Expressed in all tissues examined, including brain, heart, lung, liver, pancreas, kidney, placenta and skeletal muscle. However, kinase activity is not uniform, with highest kinase activity in splenocytes. In blood, highly expressed in
• Sequence:

  MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRWCGAEG
  DYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDF
  GLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKY
  ERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
  ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPVSGMERERKVSMRLHR
  GAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR

• Structural information:
  • Protein Domains: (9..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 3UYS 3UYT 3UZP 4HGT 4HNF 4KB8 4KBA 4KBC 4KBK 4TN6 4TW9 4TWC 5IH4 5IH5 5IH6 5MQV 5OKT 5W4W 6F1W 6F26 6GZM 6HMP 6HMR
  • PDBsum: 3UYS 3UYT 3UZP 4HGT 4HNF 4KB8 4KBA 4KBC 4KBK 4TN6 4TW9 4TWC 5IH4 5IH5 5IH6 5MQV 5OKT 5W4W 6F1W 6F26 6GZM 6HMP 6HMR
  • DIP: 39735
  • STRING: ENSP00000324464
• Other Databases: GeneCards:  CSNK1D  Malacards:  CSNK1D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	ISS	biological process
GO:2000052	positive regulation of non-canonical Wnt signaling pathway	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	ISS	molecular function
GO:1905426	positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation	IC	biological process
GO:0007020	microtubule nucleation	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:1905515	non-motile cilium assembly	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0071539	protein localization to centrosome	IMP	biological process
GO:0071539	protein localization to centrosome	IMP	biological process
GO:0071539	protein localization to centrosome	IMP	biological process
GO:0071539	protein localization to centrosome	IMP	biological process
GO:0061512	protein localization to cilium	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0042752	regulation of circadian rhythm	IBA	biological process
GO:0051225	spindle assembly	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:1905515	non-motile cilium assembly	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0051225	spindle assembly	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	ISS	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04540	Gap junction
hsa04340	Hedgehog signaling pathway
hsa04710	Circadian rhythm
P06959	CCKR signaling map

Diseases

Associated diseases	References
Familial advanced sleep phase syndrome	KEGG:H00688
Familial advanced sleep phase syndrome	KEGG:H00688
Alzheimer's disease	PMID:10514399
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq