• Gene id: 1452

Gene Summary

• Gene Symbol: CSNK1A1   Gene   UCSC   Ensembl
• Aliases: CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
• Gene name: casein kinase 1 alpha 1
• Alternate names: casein kinase I isoform alpha, CKI-alpha, clock regulator kinase, down-regulated in lung cancer, epididymis secretory sperm binding protein Li 77p,
• Gene location: 5q32 (120201210: 120196698)     Exons: 8     NC_000012.12
• OMIM: 600505

Protein Summary

• Protein general information: P48729  
  • Name: Casein kinase I isoform alpha (CKI alpha) (EC 2.7.11.1) (CK1)
  • Length: 337  
  • Mass: 38915
• Sequence:

  MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPH
  IRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHC
  NKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLK
  AATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
  LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

• Structural information:
  • Protein Domains: (17..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 5FQD 6GZD
  • PDBsum: 5FQD 6GZD
  • DIP: 40367
  • STRING: ENSP00000421689
• Other Databases: GeneCards:  CSNK1A1  Malacards:  CSNK1A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904424	regulation of GTP binding	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IC	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	colocalizes with
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0045095	keratin filament	IDA	colocalizes with
GO:0045104	intermediate filament cytoskeleton organization	IMP	biological process
GO:0036064	ciliary basal body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005929	cilium	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:1904885	beta-catenin destruction complex assembly	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0000902	cell morphogenesis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa04310	Wnt signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04340	Hedgehog signaling pathway
P06959	CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID:10514399
Inclusion body myositis	PMID:18191026
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881