• Gene id: 144811

Gene Summary

• Gene Symbol: LACC1   Gene   UCSC   Ensembl
• Aliases: C13orf31, FAMIN, JUVAR
• Gene name: laccase domain containing 1
• Alternate names: laccase domain-containing protein 1, fatty acid metabolism-immunity nexus, laccase (multicopper oxidoreductase) domain containing 1,
• Gene location: 13q14.11 (43879177: 43893931)     Exons: 10     NC_000013.11
• Gene summary(Entrez): This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein f
• OMIM: 613409

Protein Summary

• Protein general information: Q8IV20  
  • Name: Laccase domain containing protein 1 (Fatty acid metabolism immunity nexus)
  • Length: 430  
  • Mass: 47780
• Sequence:

  MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLSALLEE
  FEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRGGLFKQSIEIN
  VITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVV
  QENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAALGADCIPIVFADPVKKACGVA
  HAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESAEAFHNLHPACVQLFDSPNPCIDIRK
  ATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFGTQIGFISIKE

• Structural information:
  • Interpro: IPR003730  IPR038371  IPR011324  
  • CDD: cd16833
  • STRING: ENSP00000391747
• Other Databases: GeneCards:  LACC1  Malacards:  LACC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005507	copper ion binding	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0002367	cytokine production involved in immune response	IDA	biological process
GO:0004000	adenosine deaminase activity	IDA	molecular function
GO:0004731	purine-nucleoside phosphorylase activity	IDA	molecular function
GO:0017061	S-methyl-5-thioadenosine phosphorylase activity	IDA	molecular function
GO:0047975	guanosine phosphorylase activity	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0002221	pattern recognition receptor signaling pathway	IDA	biological process
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	biological process
GO:0002221	pattern recognition receptor signaling pathway	IDA	biological process
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor	IDA	NOT|molecular function
GO:0030641	regulation of cellular pH	IDA	biological process
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor	IDA	NOT|molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:1900542	regulation of purine nucleotide metabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0017061	S-methyl-5-thioadenosine phosphorylase activity	IEA	molecular function
GO:0004000	adenosine deaminase activity	IEA	molecular function
GO:0004731	purine-nucleoside phosphorylase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)