• Gene id: 144715

Gene Summary

• Gene Symbol: RAD9B   Gene   UCSC   Ensembl
• Gene name: RAD9 checkpoint clamp component B
• Alternate names: cell cycle checkpoint control protein RAD9B, DNA repair exonuclease rad9 homolog B, RAD9 homolog B,
• Gene location: 12q24.11 (110501650: 110534631)     Exons: 5     NC_000012.12
• OMIM: 608368

Protein Summary

• Protein general information: Q6WBX8  
  • Name: Cell cycle checkpoint control protein RAD9B (DNA repair exonuclease rad9 homolog B) (hRAD9B)
  • Length: 426  
  • Mass: 47832
  • Tissue specificity: Expressed in testis and skeletal muscle. {ECO
• Sequence:

  MLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQHYQWSALVKMSENEL
  DTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVIQFFYRHGIKRTHNICFQESQPLQVIFDKNV
  CTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMDTEITF
  CFKELKGILTFSEATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDLIEK
  KAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESSVSNTEEVPGSLCLRKFSC
  MFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNGSDAKYFCII

• Structural information:
  • Interpro: IPR026584  IPR007268  
  • STRING: ENSP00000376440
• Other Databases: GeneCards:  RAD9B  Malacards:  RAD9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006281	DNA repair	IBA	biological process
GO:0000076	DNA replication checkpoint	IBA	biological process
GO:0071479	cellular response to ionizing radiation	IBA	biological process
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0030896	checkpoint clamp complex	IBA	cellular component
GO:0008408	3'-5' exonuclease activity	IBA	molecular function
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0030896	checkpoint clamp complex	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)