• Gene id: 1445

Gene Summary

• Gene Symbol: CSK   Gene   UCSC   Ensembl
• Gene name: C-terminal Src kinase
• Alternate names: tyrosine-protein kinase CSK, C-Src kinase, CSK, non-receptor tyrosine kinase, c-src tyrosine kinase, protein-tyrosine kinase CYL,
• Gene location: 15q24.1 (74782079: 74803197)     Exons: 16     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-re
• OMIM: 172470

Protein Summary

• Protein general information: P41240  
  • Name: Tyrosine protein kinase CSK (EC 2.7.10.2) (C Src kinase) (Protein tyrosine kinase CYL)
  • Length: 450  
  • Mass: 50704
  • Tissue specificity: Expressed in lung and macrophages. {ECO
• Sequence:

  MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGT
  KLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLM
  QLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK
  NDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
  AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGIL
  LWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELHL

• Structural information:
  • Protein Domains: (9..7-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (82..17-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (195..44-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR035027  IPR011009  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd09937
  • PDB: 1BYG 1CSK 3D7T 3D7U 3EAC 3EAZ
  • PDBsum: 1BYG 1CSK 3D7T 3D7U 3EAC 3EAZ
  • STRING: ENSP00000220003
• Other Databases: GeneCards:  CSK  Malacards:  CSK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	TAS	cellular component
GO:0034332	adherens junction organization	IBA	biological process
GO:0060368	regulation of Fc receptor mediated stimulatory signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0008022	protein C-terminus binding	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070064	proline-rich region binding	IEA	molecular function
GO:0060368	regulation of Fc receptor mediated stimulatory signaling pathway	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0010989	negative regulation of low-density lipoprotein particle clearance	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0050765	negative regulation of phagocytosis	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0034332	adherens junction organization	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0042997	negative regulation of Golgi to plasma membrane protein transport	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IPI	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
P06959	CCKR signaling map

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:9918913
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq