• Gene id: 144455

Gene Summary

• Gene Symbol: E2F7   Gene   UCSC   Ensembl
• Gene name: E2F transcription factor 7
• Alternate names: transcription factor E2F7, E2F-7,
• Gene location: 12q21.2 (77065579: 77021250)     Exons: 14     NC_000012.12
• Gene summary(Entrez): E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM, May 2008]

Protein Summary

• Protein general information: Q96AV8  
  • Name: Transcription factor E2F7 (E2F 7)
  • Length: 911  
  • Mass: 99888
• Sequence:

  MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKFTPERNPITPVKFVDR
  QQAEPWTPTANLKMLISAASPDIRDREKKKGLFRPIENKDDAFTDSLQLDVVGDSAVDEFEKQRPSRKQKSLGLL
  CQKFLARYPSYPLSTEKTTISLDEVAVSLGVERRRIYDIVNVLESLHLVSRVAKNQYGWHGRHSLPKTLRNLQRL
  GEEQKYEEQMAYLQQKELDLIDYKFGERKKDGDPDSQEQQLLDFSEPDCPSSSANSRKDKSLRIMSQKFVMLFLV
  SKTKIVTLDVAAKILIEESQDAPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGRKPAFKWIGPVDFSSSD
  EELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAA
  VYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVS
  LASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEER
  KPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLV
  SSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPAGLNGFNVLLSGSQTPPTVGPSSGQLPSFSVPCMVLPS
  PPLGPFPVLYSPAMPGPVSSTLGALPNTGPVNFSLPGLGSIAQLLVGPTAVVNPKSSTLPSADPQLQSQPSLNLS
  PVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQ
  RRLEIPSGGAD

• Structural information:
  • Interpro: IPR015633  IPR003316  IPR036388  IPR036390  
  • STRING: ENSP00000323246
• Other Databases: GeneCards:  E2F7  Malacards:  E2F7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0071930	negative regulation of transcription involved in G1/S transition of mitotic cell cycle	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	ISS	biological process
GO:0060718	chorionic trophoblast cell differentiation	ISS	biological process
GO:0032877	positive regulation of DNA endoreduplication	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0001217	DNA-binding transcription repressor activity	ISS	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0002040	sprouting angiogenesis	IMP	biological process
GO:0001890	placenta development	ISS	biological process
GO:0070365	hepatocyte differentiation	ISS	biological process
GO:0060707	trophoblast giant cell differentiation	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0032466	negative regulation of cytokinesis	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0060718	chorionic trophoblast cell differentiation	IEA	biological process
GO:0032877	positive regulation of DNA endoreduplication	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0070365	hepatocyte differentiation	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0032466	negative regulation of cytokinesis	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0071930	negative regulation of transcription involved in G1/S transition of mitotic cell cycle	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	ISS	biological process
GO:0060718	chorionic trophoblast cell differentiation	ISS	biological process
GO:0032877	positive regulation of DNA endoreduplication	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0001217	DNA-binding transcription repressor activity	ISS	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0002040	sprouting angiogenesis	IMP	biological process
GO:0001890	placenta development	ISS	biological process
GO:0070365	hepatocyte differentiation	ISS	biological process
GO:0060707	trophoblast giant cell differentiation	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0032466	negative regulation of cytokinesis	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0060718	chorionic trophoblast cell differentiation	IEA	biological process
GO:0032877	positive regulation of DNA endoreduplication	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0070365	hepatocyte differentiation	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0032466	negative regulation of cytokinesis	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq