• Gene id: 144245

Gene Summary

• Gene Symbol: ALG10B   Gene   UCSC   Ensembl
• Aliases: ALG10, KCR1
• Gene name: ALG10 alpha-1,2-glucosyltransferase B
• Alternate names: putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, ALG10B, alpha-1,2-glucosyltransferase, alpha-1,2-glucosyltransferase ALG10-A, alpha-2-glucosyltransferase ALG10-B, asparagine-linked glycosylation 10 homolog B (yeast, alpha-1,2-gl,
• Gene location: 12q12 (38316678: 38329724)     Exons: 4     NC_000012.12
• OMIM: 603313

Protein Summary

• Protein general information: Q5I7T1  
  • Name: Putative Dol P Glc:Glc(2)Man(9)GlcNAc(2) PP Dol alpha 1,2 glucosyltransferase (EC 2.4.1.256) (Alpha 1,2 glucosyltransferase ALG10 A) (Alpha 2 glucosyltransferase ALG10 B) (Asparagine linked glycosylation protein 10 homolog B) (Potassium channel regulator
  • Length: 473  
  • Mass: 55448
  • Tissue specificity: Highly expressed in heart, placenta, liver, kidney and pancreas. Weakly expressed in lung, skeletal muscle and brain. {ECO
• Sequence:

  MAQLEGYCFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYLVSVGV
  VKPAIWIFAWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLY
  YTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKG
  PFAEFRKILQFLLAYSMSFKNLSMLFCLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLF
  FSFPHLLSPSKIKTFLSLVWKHGILFLVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWKRVFQRYAILKYLLVP
  AYIFAGWSIADSLKSKPIFWNLMFFICLFIVIVPQKLLEFRYFILPYVIYRLNITLPPTSRLVCELSCYAIVNFI
  TFYIFLNKTFQWPNSQDIQRFMW

• Structural information:
  • Interpro: IPR016900  
  • STRING: ENSP00000310120
• Other Databases: GeneCards:  ALG10B  Malacards:  ALG10B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IBA	molecular function
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0006488	dolichol-linked oligosaccharide biosynthetic process	IEA	biological process
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016740	transferase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:1901980	positive regulation of inward rectifier potassium channel activity	IMP	biological process
GO:0006486	protein glycosylation	IMP	biological process
GO:0060050	positive regulation of protein glycosylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)