• Gene id: 1442

Gene Summary

• Gene Symbol: CSH1   Gene   UCSC   Ensembl
• Aliases: CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
• Gene name: chorionic somatomammotropin hormone 1
• Alternate names: chorionic somatomammotropin hormone 1, Chorionic somatomammotropin hormone 2, choriomammotropin, chorionic somatomammotropin A, chorionic somatomammotropin-1, growth hormone B3, placental lactogen,
• Gene location: 17q23.3 (63896573: 63894917)     Exons: 5     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same t
• OMIM: 616309

Protein Summary

• Protein general information: P0DML2  
  • Name: Chorionic somatomammotropin hormone 1 (Choriomammotropin) (Lactogen) (Placental lactogen) (PL)
  • Length: 217  
  • Mass: 25020
• Sequence:

  MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQ
  TSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTL
  MGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

• Structural information:
  • Interpro: IPR009079  IPR001400  IPR018116  
  • Prosite: PS00266 PS00338
  • PDB: 1Z7C
  • PDBsum: 1Z7C
  • STRING: ENSP00000316416
• Other Databases: GeneCards:  CSH1  Malacards:  CSH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060396	growth hormone receptor signaling pathway	IBA	biological process
GO:0048513	animal organ development	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005131	growth hormone receptor binding	IBA	molecular function
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0045927	positive regulation of growth	IBA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0031667	response to nutrient levels	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0005179	hormone activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0031904	endosome lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04935	Growth hormone synthesis, secretion and action

Diseases

Associated diseases	References
Male factor infertility	MIK: 6601587
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray