• Gene id: 144195

Gene Summary

• Gene Symbol: SLC2A14   Gene   UCSC   Ensembl
• Aliases: GLUT14, SLC2A3P3
• Gene name: solute carrier family 2 member 14
• Alternate names: solute carrier family 2, facilitated glucose transporter member 14, glucose transporter type 14, solute carrier family 2 (facilitated glucose transporter), member 14, solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3,
• Gene location: 12p13.31 (7891195: 7812513)     Exons: 21     NC_000012.12
• Gene summary(Entrez): Members of the glucose transporter (GLUT) family, including SLC2A14, are highly conserved integral membrane proteins that transport hexoses such as glucose and fructose into all mammalian cells. GLUTs show tissue and cell-type specific expression (Wu and
• OMIM: 611039

Protein Summary

• Protein general information: Q8TDB8  
  • Name: Solute carrier family 2, facilitated glucose transporter member 14 (Glucose transporter type 14) (GLUT 14)
  • Length: 520  
  • Mass: 56320
  • Tissue specificity: Mainly expressed in testis (PubMed
• Sequence:

  MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKAN
  APPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLV
  IGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAA
  LPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
  QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTV
  SLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYY
  LGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV

• Structural information:
  • Interpro: IPR002945  IPR020846  IPR005828  IPR036259  IPR003663   IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • STRING: ENSP00000445929
• Other Databases: GeneCards:  SLC2A14  Malacards:  SLC2A14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070837	dehydroascorbic acid transport	IDA	biological process
GO:0033300	dehydroascorbic acid transmembrane transporter activity	IDA	molecular function
GO:1904659	glucose transmembrane transport	IDA	biological process
GO:0005355	glucose transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R