• Gene id: 1440

Gene Summary

• Gene Symbol: CSF3   Gene   UCSC   Ensembl
• Aliases: C17orf33, CSF3OS, GCSF
• Gene name: colony stimulating factor 3
• Alternate names: granulocyte colony-stimulating factor, filgrastim, granulocyte-colony stimulating factor, lenograstim, pluripoietin,
• Gene location: 17q21.1 (40015439: 40017812)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modifi
• OMIM: 609873

Protein Summary

• Protein general information: P09919  
  • Name: Granulocyte colony stimulating factor (G CSF) (Pluripoietin) (Filgrastim) (Lenograstim)
  • Length: 207  
  • Mass: 22293
• Sequence:

  MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLC
  HPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTI
  WQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

• Structural information:
  • Interpro: IPR009079  IPR040117  IPR030474  IPR030473  
  • Prosite: PS00254
  • PDB: 1CD9 1GNC 1PGR 1RHG 2D9Q 5GW9 5ZO6
  • PDBsum: 1CD9 1GNC 1PGR 1RHG 2D9Q 5GW9 5ZO6
  • DIP: 61120
  • STRING: ENSP00000225474
• Other Databases: GeneCards:  CSF3  Malacards:  CSF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0045639	positive regulation of myeloid cell differentiation	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005130	granulocyte colony-stimulating factor receptor binding	IBA	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045639	positive regulation of myeloid cell differentiation	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005130	granulocyte colony-stimulating factor receptor binding	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0045639	positive regulation of myeloid cell differentiation	IEA	biological process
GO:0005130	granulocyte colony-stimulating factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	NAS	biological process
GO:0005125	cytokine activity	NAS	molecular function
GO:0030851	granulocyte differentiation	NAS	biological process
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04640	Hematopoietic cell lineage
hsa04657	IL-17 signaling pathway
hsa05144	Malaria

Diseases

Associated diseases	References
Limb ischemia	PMID:16224058
Limb ischemia	PMID:23294128
Pleurisy	PMID:8841835
anterior ischemic optic neuropathy	PMID:24316388
neutropenia	PMID:10654961
Cognitive disorder	PMID:20410588
Transient cerebral ischemia	PMID:12624302
Brain ischemia	PMID:18832793
Asthma	PMID:21396376
Cerebral infarction	PMID:19298757
Myocardial infarction	PMID:15639484
Pulmonary hypertension	PMID:17186992
Pulmonary hypertension	PMID:12524378
Lung disease	PMID:21155037
myeloid leukemia	PMID:7510191
acute myeloid leukemia	PMID:10673519
Pulmonary emphysema	PMID:19537526
acute lymphocytic leukemia	PMID:9250830
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881