• Gene id: 1439

Gene Summary

• Gene Symbol: CSF2RB   Gene   UCSC   Ensembl
• Aliases: CD131, CDw131, IL3RB, IL5RB, SMDP5, betaGMR
• Gene name: colony stimulating factor 2 receptor subunit beta
• Alternate names: cytokine receptor common subunit beta, GM-CSF/IL-3/IL-5 receptor common beta subunit, GM-CSF/IL-3/IL-5 receptor common beta-chain, beta common cytokine receptor, beta-GM-CSF receptor, colony stimulating factor 2 receptor beta common subunit, colony stimulating ,
• Gene location: 22q12.3 (36913573: 36940448)     Exons: 14     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is the common beta chain of the high affinity receptor for IL-3, IL-5 and CSF. Defects in this gene have been reported to be associated with protein alveolar proteinosis (PAP). [provided by RefSeq, Jul 2008]
• OMIM: 138981

Protein Summary

• Protein general information: P32927  
  • Name: Cytokine receptor common subunit beta (CDw131) (GM CSF/IL 3/IL 5 receptor common beta subunit) (CD antigen CD131)
  • Length: 897  
  • Mass: 97336
• Sequence:

  MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSC
  DLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLL
  TWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGR
  PSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
  HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQ
  YRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMWVLALIVI
  FLTIAVLLALRFCGIYGYRLRRKWEEKIPNPSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVF
  PVGFGDSEVSPLTIEDPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
  SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQGAAGSPSLESGGGPA
  PPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFTPNSGASSVSLVPSLGLPSDQTPSLCPGLAS
  GPPGAPGPVKSGFEGYVELPPIEGRSPRSPRNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFL
  PGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC

• Structural information:
  • Protein Domains: (133..24-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (339..43-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR003531  IPR013783  IPR011365   IPR015373  IPR015321  
  • Prosite: PS50853 PS01355
  • CDD: cd00063
  • PDB: 1C8P 1EGJ 1GH7 2GYS 2NA8 2NA9 4NKQ 5DWU
  • PDBsum: 1C8P 1EGJ 1GH7 2GYS 2NA8 2NA9 4NKQ 5DWU
  • DIP: 127
  • STRING: ENSP00000384053
• Other Databases: GeneCards:  CSF2RB  Malacards:  CSF2RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007585	respiratory gaseous exchange by respiratory system	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038156	interleukin-3-mediated signaling pathway	IEA	biological process
GO:0038043	interleukin-5-mediated signaling pathway	IEA	biological process
GO:0036016	cellular response to interleukin-3	IEA	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004914	interleukin-5 receptor activity	TAS	contributes to
GO:0004912	interleukin-3 receptor activity	TAS	contributes to
GO:0030526	granulocyte macrophage colony-stimulating factor receptor complex	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04210	Apoptosis

Diseases

Associated diseases	References
Congenital pulmonary alveolar proteinosis	KEGG:H01122
Congenital pulmonary alveolar proteinosis	KEGG:H01122
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)