• Gene id: 143686

Gene Summary

• Gene Symbol: SESN3   Gene   UCSC   Ensembl
• Aliases: SEST3
• Gene name: sestrin 3
• Alternate names: sestrin-3,
• Gene location: 11q21 (95232535: 95165512)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the sestrin family of stress-induced proteins. The encoded protein reduces the levels of intracellular reactive oxygen species induced by activated Ras downstream of RAC-alpha serine/threonine-protein kinase (Akt) and FoxO tr
• OMIM: 607768

Protein Summary

• Protein general information: P58005  
  • Name: Sestrin 3
  • Length: 492  
  • Mass: 57291
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSGRLDNI
  TQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYVPQ
  RLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFR
  LISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFV
  VSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYSDIGHLL
  DEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKR
  MYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT

• Structural information:
  • Interpro: IPR029032  IPR006730  
  • DIP: 62045
  • STRING: ENSP00000441927
• Other Databases: GeneCards:  SESN3  Malacards:  SESN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031932	TORC2 complex	IBA	colocalizes with
GO:0061700	GATOR2 complex	IBA	colocalizes with
GO:0070728	leucine binding	IBA	molecular function
GO:1904262	negative regulation of TORC1 signaling	IBA	biological process
GO:1990253	cellular response to leucine starvation	IBA	biological process
GO:0016239	positive regulation of macroautophagy	IBA	biological process
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IBA	molecular function
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:0071233	cellular response to leucine	IBA	biological process
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1901031	regulation of response to reactive oxygen species	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0046626	regulation of insulin receptor signaling pathway	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:1904262	negative regulation of TORC1 signaling	IEA	biological process
GO:0051896	regulation of protein kinase B signaling	IEA	biological process
GO:0038203	TORC2 signaling	IEA	biological process
GO:0031932	TORC2 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04211	Longevity regulating pathway
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray