• Gene id: 143471

Gene Summary

• Gene Symbol: PSMA8   Gene   UCSC   Ensembl
• Aliases: PSMA7L
• Gene name: proteasome 20S subunit alpha 8
• Alternate names: proteasome subunit alpha-type 8, alpha4s, proteasome (prosome, macropain) subunit, alpha type, 8, proteasome alpha 4 subunit, proteasome subunit alpha 8, proteasome subunit alpha type 7-like protein variant 1,
• Gene location: 18q11.2 (26133868: 26193354)     Exons: 8     NC_000018.10
• OMIM: 617841

Protein Summary

• Protein general information: Q8TAA3  
  • Name: Proteasome subunit alpha type 8 (EC 3.4.25.1) (Proteasome alpha 4 subunit) (Alpha4s) (Proteasome subunit alpha type 7 like)
  • Length: 256  
  • Mass: 28530
• Sequence:

  MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDHVCMAF
  AVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGIS
  RLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPL
  KMFSAKEVELYVTEIEKEKEEAEKKKSKKSV

• Structural information:
  • Interpro: IPR029055  IPR023332  IPR000426  IPR001353  
  • Prosite: PS00388 PS51475
  • STRING: ENSP00000311121
• Other Databases: GeneCards:  PSMA8  Malacards:  PSMA8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010498	proteasomal protein catabolic process	IBA	biological process
GO:0010499	proteasomal ubiquitin-independent protein catabolic process	IBA	biological process
GO:0019773	proteasome core complex, alpha-subunit complex	IBA	cellular component
GO:0004175	endopeptidase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005839	proteasome core complex	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019773	proteasome core complex, alpha-subunit complex	ISS	cellular component
GO:0051321	meiotic cell cycle	ISS	biological process
GO:1990111	spermatoproteasome complex	ISS	cellular component
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0019773	proteasome core complex, alpha-subunit complex	IEA	cellular component
GO:0051603	proteolysis involved in cellular protein catabolic process	IEA	biological process
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0005839	proteasome core complex	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000502	proteasome complex	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:1990111	spermatoproteasome complex	IEA	cellular component
GO:0060631	regulation of meiosis I	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa05017	Spinocerebellar ataxia
hsa03050	Proteasome

Diseases

Associated diseases	References
Male infertility	MIK: 31358751
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
31358751	Male infertility				Male infertility