• Gene id: 143425

Gene Summary

• Gene Symbol: SYT9   Gene   UCSC   Ensembl
• Gene name: synaptotagmin 9
• Alternate names: synaptotagmin-9, synaptotagmin IX, sytIX,
• Gene location: 11p15.4 (7238783: 7470031)     Exons: 12     NC_000011.10
• OMIM: 600377

Protein Summary

• Protein general information: Q86SS6  
  • Name: Synaptotagmin 9 (Synaptotagmin IX) (SytIX)
  • Length: 491  
  • Mass: 56188
• Sequence:

  MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSW
  KLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAH
  GVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLN
  FILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEA
  RKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIK
  ARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQIHLSIAVMDYDRVGHN
  EIIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLVEKR

• Structural information:
  • Protein Domains: (220..34-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (352..48-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR001565  IPR028691  
  • Prosite: PS50004
  • STRING: ENSP00000324419
• Other Databases: GeneCards:  SYT9  Malacards:  SYT9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0031045	dense core granule	IBA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0019905	syntaxin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0000149	SNARE binding	IEA	molecular function
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0099502	calcium-dependent activation of synaptic vesicle fusion	IEA	biological process
GO:0031045	dense core granule	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0031045	dense core granule	IEA	cellular component
GO:0030141	secretory granule	IEA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0030672	synaptic vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq