• Gene id: 143282

Gene Summary

• Gene Symbol: FGFBP3   Gene   UCSC   Ensembl
• Aliases: C10orf13, FGF-BP3
• Gene name: fibroblast growth factor binding protein 3
• Alternate names: fibroblast growth factor-binding protein 3, FGF-binding protein 3, FGFBP-3,
• Gene location: 10q23.32 (91909485: 91906583)     Exons: 2     NC_000010.11

Protein Summary

• Protein general information: Q8TAT2  
  • Name: Fibroblast growth factor binding protein 3 (FGF BP3) (FGF binding protein 3) (FGFBP 3)
  • Length: 258  
  • Mass: 27590
• Sequence:

  MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSE
  LALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPR
  ASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGP
  DPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG

• Structural information:
  • Interpro: IPR010510  
  • STRING: ENSP00000339067
• Other Databases: GeneCards:  FGFBP3  Malacards:  FGFBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007267	cell-cell signaling	IBA	biological process
GO:0019838	growth factor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0043117	positive regulation of vascular permeability	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0008201	heparin binding	IDA	molecular function
GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881