• Gene id: 1432

Gene Summary

• Gene Symbol: MAPK14   Gene   UCSC   Ensembl
• Aliases: CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
• Gene name: mitogen-activated protein kinase 14
• Alternate names: mitogen-activated protein kinase 14, CSAID-binding protein, Csaids binding protein, MAP kinase 14, MAP kinase Mxi2, MAP kinase p38 alpha, MAX-interacting protein 2, cytokine suppressive anti-inflammatory drug binding protein, mitogen-activated protein kin,
• Gene location: 6p21.31 (36027676: 36122963)     Exons: 22     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
• OMIM: 600289

Protein Summary

• Protein general information: Q16539  
  • Name: Mitogen activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti inflammatory drug binding protein) (CSAID binding protein) (CSBP) (MAP kinase MXI2) (MAX interacting protein 2) (Mitogen activated protein kinase p38 a
  • Length: 360  
  • Mass: 41,293
• Sequence:

  MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLL
  KHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRD
  LKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPG
  TDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
  QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

• Structural information:
  • Protein Domains: Protein (24-308)
  • Interpro: IPR011009  IPR003527  IPR008352  IPR000719  IPR017441  
  • Prosite: PS01351 PS00107 PS50011
  • PDB: 1A9U 1BL6 1BL7 1BMK 1DI9 1IAN 1KV1 1KV2 1M7Q 1OUK 1OUY 1OVE 1OZ1 1R39 1R3C 1W7H 1W82 1W83 1W84 1WBN 1WBO 1WBS 1WBT 1WBV 1WBW 1WFC 1YQJ 1ZYJ 1ZZ2 1ZZL 2BAJ 2BAK 2BAL 2BAQ 2FSL 2FSM 2FSO 2FST 2GFS 2I0H 2LGC 2NPQ 2OKR 2ONL 2QD9 2RG5 2RG6 2Y8O 2YIS 2YIW 2YIX
  • PDBsum: 1A9U 1BL6 1BL7 1BMK 1DI9 1IAN 1KV1 1KV2 1M7Q 1OUK 1OUY 1OVE 1OZ1 1R39 1R3C 1W7H 1W82 1W83 1W84 1WBN 1WBO 1WBS 1WBT 1WBV 1WBW 1WFC 1YQJ 1ZYJ 1ZZ2 1ZZL 2BAJ 2BAK 2BAL 2BAQ 2FSL 2FSM 2FSO 2FST 2GFS 2I0H 2LGC 2NPQ 2OKR 2ONL 2QD9 2RG5 2RG6 2Y8O 2YIS 2YIW 2YIX
  • DIP: 30987
  • STRING: ENSP00000229794
• Other Databases: GeneCards:  MAPK14  Malacards:  MAPK14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0001502	cartilage condensation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	IEA	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0009749	response to glucose	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010831	positive regulation of myotube differentiation	ISS	biological process
GO:0014835	myoblast differentiation involved in skeletal muscle regeneration	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032495	response to muramyl dipeptide	IEA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035994	response to muscle stretch	IEA	biological process
GO:0038066	p38MAPK cascade	ISS	biological process
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0042770	signal transduction in response to DNA damage	IMP	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IMP	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051146	striated muscle cell differentiation	IEA	biological process
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0051525	NFAT protein binding	ISS	molecular function
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070935	3'-UTR-mediated mRNA stabilization	TAS	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0090400	stress-induced premature senescence	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:1900015	regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:1901741	positive regulation of myoblast fusion	ISS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0001502	cartilage condensation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005623	cell	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	IEA	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0009749	response to glucose	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010831	positive regulation of myotube differentiation	IEA	biological process
GO:0010831	positive regulation of myotube differentiation	ISS	biological process
GO:0014835	myoblast differentiation involved in skeletal muscle regeneration	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032495	response to muramyl dipeptide	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035994	response to muscle stretch	IEA	biological process
GO:0038066	p38MAPK cascade	IEA	biological process
GO:0038066	p38MAPK cascade	ISS	biological process
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0042770	signal transduction in response to DNA damage	IMP	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IEA	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IMP	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051146	striated muscle cell differentiation	IEA	biological process
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0051403	stress-activated MAPK cascade	IEA	biological process
GO:0051525	NFAT protein binding	IEA	molecular function
GO:0051525	NFAT protein binding	ISS	molecular function
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070935	3'-UTR-mediated mRNA stabilization	TAS	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0090400	stress-induced premature senescence	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:1900015	regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:1901741	positive regulation of myoblast fusion	ISS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010831	positive regulation of myotube differentiation	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0038066	p38MAPK cascade	ISS	biological process
GO:0042770	signal transduction in response to DNA damage	IMP	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IMP	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0051525	NFAT protein binding	ISS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070935	3'-UTR-mediated mRNA stabilization	TAS	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IMP	biological process
GO:0090400	stress-induced premature senescence	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:1900015	regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:1901741	positive regulation of myoblast fusion	ISS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04068	FoxO signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04114	Oocyte meiosis
hsa04218	Cellular senescence
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04611	Platelet activation
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04912	GnRH signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04917	Prolactin signaling pathway
hsa04926	Relaxin signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa04723	Retrograde endocannabinoid signaling
hsa04722	Neurotrophin signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04380	Osteoclast differentiation
hsa04714	Thermogenesis
hsa05205	Proteoglycans in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05014	Amyotrophic lateral sclerosis
hsa05418	Fluid shear stress and atherosclerosis
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05161	Hepatitis B
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Obesity	GAD: 20734064
Bone diseases	GAD: 19453261
Arthritis	GAD: 20805296
Schizophrenia	GAD: 18460190
Schizophrenia	GAD: 18460190
Female infertility	INFBASE: 7889174
Asthenozoospermia	MIK: 21961242
Male pseudohermaphroditism	MIK: 7889174
Asthenozoospermia	MIK: 21961242
Asthenospermia	MIK: 21961242
Can predict poor sperm quality	MIK: 18372245
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21961242	Asthenospermia			40 (20 healthy volunteers, 20 infertile males with asthenospermia)	Male infertility	P38MAPK
18372245	Can predict poor sperm quality				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R