• Gene id: 143187

Gene Summary

• Gene Symbol: VTI1A   Gene   UCSC   Ensembl
• Aliases: MMDS3, MVti1, VTI1RP2, Vti1-rp2
• Gene name: vesicle transport through interaction with t-SNAREs 1A
• Alternate names: vesicle transport through interaction with t-SNAREs homolog 1A, SNARE Vti1a-beta protein, vesicle transport v-SNARE protein Vti1-like 2,
• Gene location: 10q25.2 (112446987: 112855367)     Exons: 15     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between
• OMIM: 617676

Protein Summary

• Protein general information: Q96AJ9  
  • Name: Vesicle transport through interaction with t SNAREs homolog 1A (Vesicle transport v SNARE protein Vti1 like 2) (Vti1 rp2)
  • Length: 217  
  • Mass: 25218
• Sequence:

  MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMYSNRMR
  SYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEML
  ENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH

• Structural information:
  • Interpro: IPR027027  IPR010989  IPR000727  IPR038407  IPR007705  
  • DIP: 44223
  • STRING: ENSP00000376792
• Other Databases: GeneCards:  VTI1A  Malacards:  VTI1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0031201	SNARE complex	ISS	cellular component
GO:0031201	SNARE complex	ISS	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	biological process
GO:0006914	autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048280	vesicle fusion with Golgi apparatus	ISS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030136	clathrin-coated vesicle	ISS	cellular component
GO:0044306	neuron projection terminus	ISS	cellular component
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0031201	SNARE complex	TAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0006896	Golgi to vacuole transport	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0000149	SNARE binding	IBA	molecular function
GO:0048280	vesicle fusion with Golgi apparatus	IBA	biological process
GO:0031902	late endosome membrane	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	IBA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0006623	protein targeting to vacuole	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0050882	voluntary musculoskeletal movement	IMP	biological process
GO:0090161	Golgi ribbon formation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq