• Gene id: 143098

Gene Summary

• Gene Symbol: MPP7   Gene   UCSC   Ensembl
• Gene name: membrane palmitoylated protein 7
• Alternate names: MAGUK p55 subfamily member 7, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7),
• Gene location: 10p12.1 (28303065: 28050992)     Exons: 22     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the p55 Stardust family of membrane-associated guanylate kinase (MAGUK) proteins, which function in the establishment of epithelial cell polarity. This family member forms a complex with the polarity protein
• OMIM: 610973

Protein Summary

• Protein general information: Q5T2T1  
  • Name: MAGUK p55 subfamily member 7
  • Length: 576  
  • Mass: 65524
• Sequence:

  MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAAL
  ADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYDPVLPPMPEDIDDEEDSVKIIRLVKNREPLG
  ATIKKDEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIQILAQSQGAITFKIIPGSKEETP
  SKEGKMFIKALFDYNPNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQAKHEADANPRAGLIPSKHFQERRLAL
  RRPEILVQPLKVSNRKSSGFRKSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVTPYRRQTNEKYRLVVLVG
  PVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSID
  SVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMI
  KSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFDKLETETHWVPVSWLHS

• Structural information:
  • Protein Domains: (10..6-)
    (/note="L27-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (67..12-)
    (/note="L27-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (139..22-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (2-)
  • Interpro: IPR008145  IPR008144  IPR020590  IPR014775  IPR004172   IPR036892  IPR035599  IPR027417  IPR001478  IPR036034  IPR036028  IPR001452  
  • Prosite: PS00856 PS50052 PS51022 PS50106 PS50002
  • CDD: cd12033
  • PDB: 3LRA 3O46
  • PDBsum: 3LRA 3O46
  • STRING: ENSP00000337907
• Other Databases: GeneCards:  MPP7  Malacards:  MPP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035591	signaling adaptor activity	NAS	molecular function
GO:0035591	signaling adaptor activity	TAS	molecular function
GO:0060090	molecular adaptor activity	IDA	molecular function
GO:0060090	molecular adaptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0070830	bicellular tight junction assembly	IDA	biological process
GO:0097025	MPP7-DLG1-LIN7 complex	IDA	cellular component
GO:0097025	MPP7-DLG1-LIN7 complex	IDA	cellular component
GO:0030010	establishment of cell polarity	TAS	biological process
GO:0031334	positive regulation of protein-containing complex assembly	TAS	biological process
GO:0071896	protein localization to adherens junction	IMP	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005912	adherens junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray