• Gene id: 1429

Gene Summary

• Gene Symbol: CRYZ   Gene   UCSC   Ensembl
• Gene name: crystallin zeta
• Alternate names: quinone oxidoreductase, NADPH:quinone reductase, crystallin, zeta (quinone reductase), epididymis secretory sperm binding protein,
• Gene location: 1p31.1 (74733407: 74705469)     Exons: 11     NC_000001.11
• Gene summary(Entrez): Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called
• OMIM: 0

Protein Summary

• Protein general information: Q08257  
  • Name: Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta crystallin)
  • Length: 329  
  • Mass: 35207
  • Tissue specificity: Only very low amounts in the lens.
• Sequence:

  MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAG
  VIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGE
  SVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEML
  ANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIG
  SQYPLEKVAEAHENIIHGSGATGKMILLL

• Structural information:
  • Interpro: IPR013149  IPR013154  IPR011032  IPR036291  IPR020843   IPR002364  
  • Prosite: PS01162
  • PDB: 1YB5
  • PDBsum: 1YB5
  • STRING: ENSP00000399805
• Other Databases: GeneCards:  CRYZ  Malacards:  CRYZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0003960	NADPH:quinone reductase activity	IBA	molecular function
GO:0070402	NADPH binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0003960	NADPH:quinone reductase activity	IDA	molecular function
GO:0070404	NADH binding	IDA	NOT|molecular function
GO:0070402	NADPH binding	IDA	molecular function
GO:0042178	xenobiotic catabolic process	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0007601	visual perception	TAS	biological process
GO:0003960	NADPH:quinone reductase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq