• Gene id: 1427

Gene Summary

• Gene Symbol: CRYGS   Gene   UCSC   Ensembl
• Aliases: CRYG8, CTRCT20
• Gene name: crystallin gamma S
• Alternate names: gamma-crystallin S, beta-crystallin S, crystallin, gamma 8,
• Gene location: 3q27.3 (8943032: 8937571)     Exons: 2     NC_000011.10
• Gene summary(Entrez): Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells l
• OMIM: 123730

Protein Summary

• Protein general information: P22914  
  • Name: Gamma crystallin S (Beta crystallin S) (Gamma S crystallin)
  • Length: 178  
  • Mass: 21007
• Sequence:

  MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMG
  LNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQY
  LLDKKEYRKPIDWGAASPAVQSFRRIVE

• Structural information:
  • Protein Domains: (6..4-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (45..8-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (94..13-)
    (/note="Beta/gam-)
  • Interpro: IPR001064  IPR011024  
  • Prosite: PS50915
  • PDB: 1HA4 2M3T 2M3U 6FD8 6IF9
  • PDBsum: 1HA4 2M3T 2M3U 6FD8 6IF9
  • DIP: 60585
  • STRING: ENSP00000376287
• Other Databases: GeneCards:  CRYGS  Malacards:  CRYGS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007601	visual perception	IBA	biological process
GO:0002088	lens development in camera-type eye	IBA	biological process
GO:0005212	structural constituent of eye lens	IBA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0002009	morphogenesis of an epithelium	IEA	biological process
GO:0002088	lens development in camera-type eye	IEA	biological process

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R