• Gene id: 142679

Gene Summary

• Gene Symbol: DUSP19   Gene   UCSC   Ensembl
• Aliases: DUSP17, LMWDSP3, SKRP1, TS-DSP1
• Gene name: dual specificity phosphatase 19
• Alternate names: dual specificity protein phosphatase 19, SAPK pathway-regulating phosphatase 1, dual specificity phosphatase TS-DSP1, low molecular weight dual specificity phosphatase 3, protein phosphatase SKRP1, stress-activated protein kinase pathway-regulating phosphatase,
• Gene location: 2q32.1 (183078746: 183100007)     Exons: 4     NC_000002.12
• Gene summary(Entrez): Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues.
• OMIM: 611437

Protein Summary

• Protein general information: Q8WTR2  
  • Name: Dual specificity protein phosphatase 19 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity phosphatase TS DSP1) (Low molecular weight dual specificity phosphatase 3) (LMW DSP3) (Protein phosphatase SKRP1) (Stress activated protein kinase pathway regulating pho
  • Length: 217  
  • Mass: 24194
  • Tissue specificity: Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest. {ECO
• Sequence:

  MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLL
  GSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHC
  NAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

• Structural information:
  • Protein Domains: (133..19-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR000340  IPR029021  IPR000387  IPR020422  
  • Prosite: PS50056 PS50054
  • PDB: 3S4E 4D3P 4D3Q 4D3R
  • PDBsum: 3S4E 4D3P 4D3Q 4D3R
  • STRING: ENSP00000346160
• Other Databases: GeneCards:  DUSP19  Malacards:  DUSP19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043405	regulation of MAP kinase activity	IBA	biological process
GO:0008579	JUN kinase phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005078	MAP-kinase scaffold activity	ISS	molecular function
GO:0030295	protein kinase activator activity	ISS	molecular function
GO:0004860	protein kinase inhibitor activity	ISS	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	ISS	molecular function
GO:0043508	negative regulation of JUN kinase activity	ISS	biological process
GO:0006469	negative regulation of protein kinase activity	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0043507	positive regulation of JUN kinase activity	ISS	biological process
GO:0045860	positive regulation of protein kinase activity	ISS	biological process
GO:0046329	negative regulation of JNK cascade	ISS	biological process
GO:0046330	positive regulation of JNK cascade	ISS	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881