Male Infertility Database

Search Result

Gene id

142

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

PARP1 Gene UCSC Ensembl

Aliases

ADPRT, ADPRT 1, ADPRT1, ARTD1, PARP, PARP-1, PPOL, pADPRT-1

Gene name

poly(ADP-ribose) polymerase 1

Alternate names

poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase), ADP-ribosyltransferase NAD(+), ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, poly (ADP-ribose) polymerase family, member 1, pol,

Gene location

1q42.12 (226408099: 226360690) Exons: 23 NC_000001.11

Gene summary(Entrez)

This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processe

OMIM

173870

SNPs

rs397515340

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000006.12   g.43670919_43670921GAA[1]
NC_000006.12   g.43670919_43670921GAA[3]
NC_000006.11   g.43638656_43638658GAA[1]
NC_000006.11   g.43638656_43638658GAA[3]
NG_023436.1   g.30890_30892GAA[1]
NG_023436.1   g.30890_30892GAA[3]
NM_152732.5   c.801_803GAA[1]
NM

rs1136410

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.226367601A>G
NC_000001.10   g.226555302A>G
NM_001618.4   c.2285T>C
NM_001618.3   c.2285T>C
NP_001609.2   p.Val762Ala|SEQ=[A/G]|GENE=PARP1

rs1805405

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.226392320G>A
NC_000001.11   g.226392320G>T
NC_000001.10   g.226580021G>A
NC_000001.10   g.226580021G>T|SEQ=[G/A/T]|GENE=PARP1

Protein Summary

Protein general information

P09874

Name: Poly [ADP ribose] polymerase 1 (PARP 1) (EC 2.4.2.30) (ADP ribosyltransferase diphtheria toxin like 1) (ARTD1) (NAD(+) ADP ribosyltransferase 1) (ADPRT 1) (Poly[ADP ribose] synthase 1)

Length: 1014 Mass: 113,084

Sequence

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFS
ELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ
LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSK
KEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTAS
APAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEAN
IRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKL
TLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKM
IFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPP
LLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATT
HNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGI
SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

Structural information

Protein Domains	BRCT. (385-476) PARP (662-779) PARP (788-1014)
Interpro:	IPR001357 IPR036420 IPR012982 IPR008288 IPR012317 IPR004102 IPR036616 IPR036930 IPR008893 IPR001510 IPR036957
Prosite:	PS50172 PS51060 PS51059 PS00347 PS50064
CDD:	cd00027
PDB:	1UK0 1UK1 1WOK 2COK 2CR9 2CS2 2DMJ 2JVN 2L30 2L31 2N8A 2RCW 2RD6 2RIQ 3GJW 3GN7 3L3L 3L3M 3OD8 3ODA 3ODC 3ODE 4AV1 4DQY 4GV7 4HHY 4HHZ 4L6S 4OPX 4OQA 4OQB 4PJT 4R5W 4R6E 4RV6 4UND 4UXB 4XHU 4ZZZ 5A00 5DS3 5HA9 5KPN 5KPO 5KPP 5KPQ 5WRQ 5WRY 5WRZ 5WS0 5WS1
PDBsum:	1UK0 1UK1 1WOK 2COK 2CR9 2CS2 2DMJ 2JVN 2L30 2L31 2N8A 2RCW 2RD6 2RIQ 3GJW 3GN7 3L3L 3L3M 3OD8 3ODA 3ODC 3ODE 4AV1 4DQY 4GV7 4HHY 4HHZ 4L6S 4OPX 4OQA 4OQB 4PJT 4R5W 4R6E 4RV6 4UND 4UXB 4XHU 4ZZZ 5A00 5DS3 5HA9 5KPN 5KPO 5KPP 5KPQ 5WRQ 5WRY 5WRZ 5WS0 5WS1
DIP:	38
MINT:
STRING:	ENSP00000355759

Other Databases

GeneCards: PARP1 Malacards: PARP1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repai r, DNA duplex unwinding	TAS	biological process
GO:0000724	double-strand break repai r via homologous recombin ation	TAS	biological process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003910	DNA ligase (ATP) activity	IBA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor comp lex	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006273	lagging strand elongation	IBA	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006293	nucleotide-excision repai r, preincision complex st abilization	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006295	nucleotide-excision repai r, DNA incision, 3'-to le sion	TAS	biological process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007005	mitochondrion organizatio n	IMP	biological process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IEA	biological process
GO:0008134	transcription factor bind ing	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016540	protein autoprocessing	IEA	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0023019	signal transduction invol ved in regulation of gene expression	IEA	biological process
GO:0030225	macrophage differentiatio n	TAS	biological process
GO:0032042	mitochondrial DNA metabol ic process	IMP	biological process
GO:0032869	cellular response to insu lin stimulus	IDA	biological process
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological process
GO:0034599	cellular response to oxid ative stress	IMP	biological process
GO:0036211	protein modification proc ess	IMP	biological process
GO:0042769	DNA damage response, dete ction of DNA damage	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042826	histone deacetylase bindi ng	IEA	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0043504	mitochondrial DNA repair	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0047485	protein N-terminus bindin g	IPI	molecular function
GO:0051103	DNA ligation involved in DNA repair	IBA	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0060391	positive regulation of SM AD protein import into nu cleus	IEA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070412	R-SMAD binding	IEA	molecular function
GO:0070911	global genome nucleotide- excision repair	TAS	biological process
GO:1903827	regulation of cellular pr otein localization	IMP	biological process
GO:1904357	negative regulation of te lomere maintenance via te lomere lengthening	ISS	biological process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IEA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repai r, DNA duplex unwinding	TAS	biological process
GO:0000724	double-strand break repai r via homologous recombin ation	TAS	biological process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003910	DNA ligase (ATP) activity	IBA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IEA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IEA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IEA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor comp lex	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006273	lagging strand elongation	IBA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006293	nucleotide-excision repai r, preincision complex st abilization	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006295	nucleotide-excision repai r, DNA incision, 3'-to le sion	TAS	biological process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological process
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0006471	protein ADP-ribosylation	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007005	mitochondrion organizatio n	IMP	biological process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IEA	biological process
GO:0008134	transcription factor bind ing	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IEA	biological process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016540	protein autoprocessing	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, tra nsferring glycosyl groups	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0023019	signal transduction invol ved in regulation of gene expression	IEA	biological process
GO:0030225	macrophage differentiatio n	TAS	biological process
GO:0032042	mitochondrial DNA metabol ic process	IMP	biological process
GO:0032869	cellular response to insu lin stimulus	IDA	biological process
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological process
GO:0034599	cellular response to oxid ative stress	IMP	biological process
GO:0036211	protein modification proc ess	IMP	biological process
GO:0042769	DNA damage response, dete ction of DNA damage	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042826	histone deacetylase bindi ng	IEA	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0043504	mitochondrial DNA repair	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0047485	protein N-terminus bindin g	IPI	molecular function
GO:0051103	DNA ligation involved in DNA repair	IBA	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0060391	positive regulation of SM AD protein import into nu cleus	IEA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IEA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070412	R-SMAD binding	IEA	molecular function
GO:0070911	global genome nucleotide- excision repair	TAS	biological process
GO:1903827	regulation of cellular pr otein localization	IMP	biological process
GO:1904357	negative regulation of te lomere maintenance via te lomere lengthening	ISS	biological process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IEA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repai r, DNA duplex unwinding	TAS	biological process
GO:0000724	double-strand break repai r via homologous recombin ation	TAS	biological process
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003910	DNA ligase (ATP) activity	IBA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular function
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor comp lex	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006273	lagging strand elongation	IBA	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006293	nucleotide-excision repai r, preincision complex st abilization	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006295	nucleotide-excision repai r, DNA incision, 3'-to le sion	TAS	biological process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0006471	protein ADP-ribosylation	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007005	mitochondrion organizatio n	IMP	biological process
GO:0008134	transcription factor bind ing	IPI	molecular function
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030225	macrophage differentiatio n	TAS	biological process
GO:0032042	mitochondrial DNA metabol ic process	IMP	biological process
GO:0032869	cellular response to insu lin stimulus	IDA	biological process
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological process
GO:0034599	cellular response to oxid ative stress	IMP	biological process
GO:0036211	protein modification proc ess	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0043504	mitochondrial DNA repair	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0047485	protein N-terminus bindin g	IPI	molecular function
GO:0051103	DNA ligation involved in DNA repair	IBA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070212	protein poly-ADP-ribosyla tion	IDA	biological process
GO:0070911	global genome nucleotide- excision repair	TAS	biological process
GO:1903827	regulation of cellular pr otein localization	IMP	biological process
GO:1904357	negative regulation of te lomere maintenance via te lomere lengthening	ISS	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04210	Apoptosis
hsa04217	Necroptosis

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer (cervical)	GAD: 16492928
Cancer (colorectal)	GAD: 17283177
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 15205355
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 15705867
Cancer	GAD: 21983785
Cancer (basal cell)	GAD: 11782372
Cancer (bladder)	GAD: 17220334
Cancer (brain)	GAD: 19124499
Cancer (lymphoma)	GAD: 18636124
Cancer (melanoma)	GAD: 21983785
Cancer (prostate)	GAD: 15342424
Cancer (breast)	GAD: 16492928
Macular degeneration	GAD: 15774926
Arthritis	GAD: 12632415
Rheumatoid arthritis	GAD: 12632415
Multiple sclerosis	GAD: 20522537
Systemic lupus erythematosus (SLE)	GAD: 10207165
Asthma	GAD: 19484672
Diabetes	GAD: 11591122
Alzheimer's disease	GAD: 17290104
Parkinson disease	GAD: 17362997
Meniere disease	GAD: 19863315
Chronic renal failure	GAD: 21085059
Human spermatogenic defect	MIK: 16996513
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Oligozoospermia	MIK: 25106941
Varicocele	MIK: 19062002
Male factor infertility	MIK: 19062002
Azoospermia	MIK: 16996513
DiGeorge syndrome	MIK: 21547351
Cryptorchidism	MIK: 21547351
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 16996513
DiGeorge anomaly	MIK: 21547351
Cryptorchidism	MIK: 21547351
Male infertility	MIK: 25106941
Oligospermia	MIK: 25106941
Role in preventing damage of mature sperm	MIK: 18339380
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Varicocele	MIK: 20629644

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26209830	Semen qual ity, Sperm motility			37 men provided semen samples for routine ana lysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase	Show abstract
26209830	Sperm moti lity			37 men provided semen samples for routine ana lysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR �p38�MAPK p53 PARP Caspase-3	Show abstract
20629644	Varicocele			35 (25 patients with varicocel e, 10 normal fe rtile controls)	Male infertility	PARP Bak and p53	Show abstract
19062002	Varicocele , Male inf ertility			24 (8 infertile varicocele pat ients, 16 ferti le volunteers)	Male infertility	PARP-1 poly(ADP-ribose) X-ray repair cross-complementing 1 and apurinic/apyrimidinic endonuclease 1] caspase 9 active caspase 3 and cleaved PARP-1	Show abstract
25106941	Male infer tility, ol igospermia	rs1136410, rS1805405	Chinese	602 (371 infert ile patients wi th idiopathic a zoospermia or o ligospermia, 23 1 controls)	Male infertility		Show abstract
21547351	DiGeorge a nomaly, cr yptorchidi sm				Male infertility	LDOC1 PARP1	Show abstract
16996513	Azoospermi a, human s permatogen esis				Male infertility		Show abstract
18339380	Role in pr eventing d amage of m ature sper m			30 (18 healthy donors, 12 infe rtile males)	Male infertility		Show abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All