• Gene id: 1413

Gene Summary

• Gene Symbol: CRYBA4   Gene   UCSC   Ensembl
• Aliases: CTRCT23, CYRBA4, MCOPCT4
• Gene name: crystallin beta A4
• Alternate names: beta-crystallin A4, beta crystallin A4 chain transcript PS, beta crystallin alpha 4 chain, beta-A4 crystallin, crystallin, beta polypeptide A4, eye lens structural protein,
• Gene location: 22q12.1 (26607981: 26630671)     Exons: 7     NC_000022.11
• Gene summary(Entrez): Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells l
• OMIM: 123631

Protein Summary

• Protein general information: P53673  
  • Name: Beta crystallin A4 (Beta A4 crystallin)
  • Length: 196  
  • Mass: 22374
• Sequence:

  MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYP
  SWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWV
  CSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ

• Structural information:
  • Protein Domains: (12..5-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (52..9-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (105..14-)
    (/note="Beta/g-)
  • Interpro: IPR001064  IPR033342  IPR011024  
  • Prosite: PS50915
  • PDB: 3LWK
  • PDBsum: 3LWK
  • STRING: ENSP00000346805
• Other Databases: GeneCards:  CRYBA4  Malacards:  CRYBA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007601	visual perception	IBA	biological process
GO:0002088	lens development in camera-type eye	IBA	biological process
GO:0005212	structural constituent of eye lens	IBA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0043010	camera-type eye development	IMP	biological process
GO:0007601	visual perception	IMP	biological process
GO:0007601	visual perception	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)