• Gene id: 1412

Gene Summary

• Gene Symbol: CRYBA2   Gene   UCSC   Ensembl
• Aliases: CTRCT42
• Gene name: crystallin beta A2
• Alternate names: beta-crystallin A2, eye lens structural protein,
• Gene location: 2q35 (218993421: 218990189)     Exons: 5     NC_000002.12
• Gene summary(Entrez): Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central
• OMIM: 612302

Protein Summary

• Protein general information: P53672  
  • Name: Beta crystallin A2 (Beta A2 crystallin)
  • Length: 197  
  • Mass: 22096
• Sequence:

  MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDY
  PRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAW
  VAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

• Structural information:
  • Protein Domains: (12..5-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (53..9-)
    'Greek (/note="Beta/gamma-crystallin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00028-)
    (106..14-)
    (/note="Beta/g-)
  • Interpro: IPR001064  IPR011024  
  • Prosite: PS50915
  • STRING: ENSP00000295728
• Other Databases: GeneCards:  CRYBA2  Malacards:  CRYBA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007601	visual perception	IBA	biological process
GO:0002088	lens development in camera-type eye	IBA	biological process
GO:0005212	structural constituent of eye lens	IBA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0002088	lens development in camera-type eye	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881