About Us

Search Result


Gene id 140890
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SREK1   Gene   UCSC   Ensembl
Aliases SFRS12, SRrp508, SRrp86
Gene name splicing regulatory glutamic acid and lysine rich protein 1
Alternate names splicing regulatory glutamine/lysine-rich protein 1, serine-arginine-rich splicing regulatory protein 508, serine/arginine-rich-splicing regulatory protein 86, splicing factor, arginine/serine-rich 12, splicing regulatory glutamic acid/lysine-rich protein 1,
Gene location 5q12.3 (66144299: 66183615)     Exons: 15     NC_000005.10
Gene summary(Entrez) This gene encodes a member of a family of serine/arginine-rich (SR) splicing proteins containing RNA recognition motif (RRM) domains. The encoded protein interacts with other SR proteins to modulate splice site selection. Alternatively spliced transcript
OMIM 607892

Protein Summary

Protein general information Q8WXA9  

Name: Splicing regulatory glutamine/lysine rich protein 1 (Serine/arginine rich splicing regulatory protein 86) (SRrp86) (Splicing factor, arginine/serine rich 12) (Splicing regulatory protein 508) (SRrp508)

Length: 508  Mass: 59380

Sequence MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNS
QTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEM
TPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRS
RSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKEREREKEREKEKERGKNKD
RDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSR
SSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKERDHISERRERERSTSMRKSSNDRDGKEK
LEKNSTSLKEKEHNKEPDSSVSKEVDDKDAPRTEENKIQHNGNCQLNEENLSTKTEAV
Structural information
Protein Domains
(66..14-)
(/note="RRM-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
Interpro:  IPR012677  IPR035979  IPR000504  IPR033568  IPR034192  
Prosite:   PS50102
CDD:   cd12260
MINT:  
STRING:   ENSP00000334538
Other Databases GeneCards:  SREK1  Malacards:  SREK1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005654 nucleoplasm
IBA cellular component
GO:0003723 RNA binding
IBA molecular function
GO:0000381 regulation of alternative
mRNA splicing, via splic
eosome
IEA biological process
GO:0003676 nucleic acid binding
IEA molecular function
GO:0005681 spliceosomal complex
IEA cellular component
GO:0008380 RNA splicing
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0006397 mRNA processing
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0016607 nuclear speck
IDA cellular component
GO:0003723 RNA binding
HDA molecular function
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract