• Gene id: 140886

Gene Summary

• Gene Symbol: PABPC5   Gene   UCSC   Ensembl
• Aliases: PABP5
• Gene name: poly(A) binding protein cytoplasmic 5
• Alternate names: polyadenylate-binding protein 5,
• Gene location: Xq21.31 (91434838: 91438583)     Exons: 2     NC_000023.11
• Gene summary(Entrez): This gene encodes a protein that binds to the polyA tail found at the 3' end of most eukaryotic mRNAs. It is thought to play a role in the regulation of mRNA metabolic processes in the cytoplasm. This gene is located in a gene-poor region within the X-spe
• OMIM: 153615

Protein Summary

• Protein general information: Q96DU9  
  • Name: Polyadenylate binding protein 5 (PABP 5) (Poly(A) binding protein 5)
  • Length: 382  
  • Mass: 43331
  • Tissue specificity: Expressed in fetal brain and in a range of adult tissues.
• Sequence:

  MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
  LNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYV
  HFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEYGPT
  ESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP
  GVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTL
  GQARRRC

• Structural information:
  • Protein Domains: (18..9-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (106..18-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (199..27-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (-)
  • Interpro: IPR012677  IPR006515  IPR035979  IPR000504  IPR003954  
  • Prosite: PS50102
  • STRING: ENSP00000308012
• Other Databases: GeneCards:  PABPC5  Malacards:  PABPC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008143	poly(A) binding	IBA	molecular function
GO:0008266	poly(U) RNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0010494	cytoplasmic stress granule	IBA	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008143	poly(A) binding	IBA	molecular function
GO:0008266	poly(U) RNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0010494	cytoplasmic stress granule	IBA	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03015	mRNA surveillance pathway
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray