• Gene id: 140883

Gene Summary

• Gene Symbol: ZNF280B   Gene   UCSC   Ensembl
• Aliases: 5'OY11.1, D87009.C22.3, SUHW2, ZNF279, ZNF632
• Gene name: zinc finger protein 280B
• Alternate names: zinc finger protein 280B, suppressor of hairy wing homolog 2, zinc finger protein 279, zinc finger protein 632,
• Gene location: 22q11.22 (22509160: 22484420)     Exons: 8     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is a transcription factor that upregulates expression of MDM2, which negatively regulates p53 expression. This gene is highly expressed in prostate cancer cells, which leads to a reduction in p53 levels and an increase in
• OMIM: 0

Protein Summary

• Protein general information: Q86YH2  
  • Name: Zinc finger protein 280B (5'OY11.1) (Suppressor of hairy wing homolog 2) (Zinc finger protein 279) (Zinc finger protein 632)
  • Length: 543  
  • Mass: 61584
• Sequence:

  MEQSCEEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKPVVSNILNRVTPGSWSRRKKY
  DHLRKDTARKLQPKSHETVTSEAVTVLPASQLESRSTDSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTD
  SLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGIIEGNSSASFPSDTFHTMNTQQSTPSNNVHTS
  LSHVQNGAPFPAAFPKDNIHFKPINTNLDRENELAKTDILSLTSQNKTFDPKKENPIVLLSDFYYGQHKGEGQPE
  QKTHTTFKCLSCVKVLKNVKFMNHVKHHLEFEKQRNDSWENHTTCQHCHRQFPTPFQLQCHIENVHTAQEPSTVC
  KICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVETHFRTCHENTKNLLCPFCLKIFKTATPYMCH
  YRGHWGKSAHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGLPPETKVTIQVSLEPLQPGSVDVASITVSTS
  DSEPSLPRSKSKISKKSH

• Structural information:
  • Interpro: IPR025243  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000480958
• Other Databases: GeneCards:  ZNF280B  Malacards:  ZNF280B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)