• Gene id: 140870

Gene Summary

• Gene Symbol: WFDC6   Gene   UCSC   Ensembl
• Aliases: C20orf171, HEL-S-295, WAP6, dJ461P17.11
• Gene name: WAP four-disulfide core domain 6
• Alternate names: WAP four-disulfide core domain protein 6, epididymis secretory protein Li 295, epididymis secretory sperm binding protein, protease inhibitor WAP6,
• Gene location: 20q13.12 (31509643: 31432400)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD

Protein Summary

• Protein general information: Q9BQY6  
  • Name: WAP four disulfide core domain protein 6 (Putative protease inhibitor WAP6)
  • Length: 131  
  • Mass: 14626
  • Tissue specificity: Ubiquitously expressed, but the highest levels are found in epididymis, testis and trachea.
• Sequence:

  MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKI
  YAVCHRRLAPAWPPYHTGGTIKKTKICSEFIYGGSQGNNNNFQTEAICLVTCKKYH

• Structural information:
  • Protein Domains: (26..7-)
    (/note="WA-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (70..12-)
    (/note="BPTI/Kunitz-inhibitor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00031"-)
  • Interpro: IPR036645  IPR002223  IPR036880  IPR008197  
  • Prosite: PS50279 PS51390
  • STRING: ENSP00000361755
• Other Databases: GeneCards:  WFDC6  Malacards:  WFDC6

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)