About Us

Search Result


Gene id 140832
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol WFDC10A   Gene   UCSC   Ensembl
Aliases C20orf146, WAP10, dJ688G8.3
Gene name WAP four-disulfide core domain 10A
Alternate names WAP four-disulfide core domain protein 10A, putative protease inhibitor WAP10A,
Gene location 20q13.12 (45629738: 45631195)     Exons: 2     NC_000020.11
Gene summary(Entrez) This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD

Protein Summary

Protein general information Q9H1F0  

Name: WAP four disulfide core domain protein 10A (Putative protease inhibitor WAP10A)

Length: 79  Mass: 8943

Sequence MAPQTLLPVLVLCVLLLQAQGGYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTYCGNVC
MSIL
Structural information
Protein Domains
(34..7-)
(/note="WAP-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00722"-)
Interpro:  IPR036645  IPR008197  
Prosite:   PS51390
STRING:   ENSP00000361726
Other Databases GeneCards:  WFDC10A  Malacards:  WFDC10A

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0045087 innate immune response
IBA biological process
GO:0019731 antibacterial humoral res
ponse
IBA biological process
GO:0005615 extracellular space
IBA cellular component
GO:0004867 serine-type endopeptidase
inhibitor activity
IBA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0030414 peptidase inhibitor activ
ity
IEA molecular function
GO:0030414 peptidase inhibitor activ
ity
IEA molecular function
GO:0010466 negative regulation of pe
ptidase activity
IEA biological process
GO:0005576 extracellular region
IEA cellular component
GO:0004867 serine-type endopeptidase
inhibitor activity
IEA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological process
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract