• Gene id: 140825

Gene Summary

• Gene Symbol: NEURL2   Gene   UCSC   Ensembl
• Aliases: C20orf163, OZZ, OZZ-E3
• Gene name: neuralized E3 ubiquitin protein ligase 2
• Alternate names: neuralized-like protein 2, neuralized homolog 2,
• Gene location: 20q13.12 (45891286: 45888471)     Exons: 2     NC_000020.11
• Gene summary(Entrez): This gene encodes a protein that is involved in the regulation of myofibril organization. This protein is likely the adaptor component of the E3 ubiquitin ligase complex in striated muscle, and it regulates the ubiquitin-mediated degradation of beta-caten
• OMIM: 606148

Protein Summary

• Protein general information: Q9BR09  
  • Name: Neuralized like protein 2
  • Length: 285  
  • Mass: 31690
  • Tissue specificity: Expressed specifically in skeletal and cardiac muscles. {ECO
• Sequence:

  MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVEIEEKEL
  GWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPTLLVEPYLRIE
  QFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQP
  LYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKDFCKYE

• Structural information:
  • Protein Domains: (23..24-)
    (/note="NHR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00400-)
    (250..28-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR037962  IPR006573  IPR001496  IPR036036  
  • Prosite: PS51065 PS50225
  • STRING: ENSP00000361596
• Other Databases: GeneCards:  NEURL2  Malacards:  NEURL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881