• Gene id: 140809

Gene Summary

• Gene Symbol: SRXN1   Gene   UCSC   Ensembl
• Aliases: C20orf139, Npn3, SRX, SRX1
• Gene name: sulfiredoxin 1
• Alternate names: sulfiredoxin-1,
• Gene location: 20p13 (653199: 646614)     Exons: 2     NC_000020.11
• OMIM: 602407

Protein Summary

• Protein general information: Q9BYN0  
  • Name: Sulfiredoxin 1 (EC 1.8.98.2)
  • Length: 137  
  • Mass: 14259
  • Tissue specificity: Widely expressed with highest levels in kidney, lung, spleen and thymus. {ECO
• Sequence:

  MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDS
  VPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

• Structural information:
  • Interpro: IPR003115  IPR036086  IPR016692  
  • PDB: 1XW3 1XW4 1YZS 2B6F 2RII 3CYI 3HY2
  • PDBsum: 1XW3 1XW4 1YZS 2B6F 2RII 3CYI 3HY2
  • DIP: 59836
  • STRING: ENSP00000371388
• Other Databases: GeneCards:  SRXN1  Malacards:  SRXN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0032542	sulfiredoxin activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0032542	sulfiredoxin activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0032542	sulfiredoxin activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0016667	oxidoreductase activity, acting on a sulfur group of donors	IDA	molecular function
GO:0006979	response to oxidative stress	IDA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray