• Gene id: 140767

Gene Summary

• Gene Symbol: NRSN1   Gene   UCSC   Ensembl
• Aliases: VMP, p24
• Gene name: neurensin 1
• Alternate names: neurensin-1, neuro-p24, vesicular membrain protein p24, vesicular membrane protein of 24 kDa, vesicular membrane protein p24,
• Gene location: 6p22.3 (24126214: 24147529)     Exons: 4     NC_000006.12
• OMIM: 616630

Protein Summary

• Protein general information: Q8IZ57  
  • Name: Neurensin 1 (Neuro p24) (Vesicular membrane protein of 24 kDa) (Vesicular membrane protein p24)
  • Length: 195  
  • Mass: 21475
  • Tissue specificity: Expressed in brain. Not detectable in other tissues tested. {ECO
• Sequence:

  MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVIL
  GLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFL
  QQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT

• Structural information:
  • Interpro: IPR024883  IPR029698  
  • STRING: ENSP00000367739
• Other Databases: GeneCards:  NRSN1  Malacards:  NRSN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007399	nervous system development	IBA	biological process
GO:0030133	transport vesicle	IBA	cellular component
GO:0043025	neuronal cell body	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0030133	transport vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0007399	nervous system development	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)