• Gene id: 140738

Gene Summary

• Gene Symbol: TMEM37   Gene   UCSC   Ensembl
• Aliases: PR, PR1
• Gene name: transmembrane protein 37
• Alternate names: voltage-dependent calcium channel gamma-like subunit, neuronal voltage-gated calcium channel gamma-like subunit, voltage-dependent calcium channel gamma subunit-like protein,
• Gene location: 2q14.2 (99532941: 99536523)     Exons: 3     NC_000010.11
• OMIM: 618831

Protein Summary

• Protein general information: Q8WXS4  
  • Name: Voltage dependent calcium channel gamma like subunit (Neuronal voltage gated calcium channel gamma like subunit) (Transmembrane protein 37)
  • Length: 190  
  • Mass: 20932
• Sequence:

  MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRD
  LGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLR
  NQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE

• Structural information:
  • Interpro: IPR029372  
  • STRING: ENSP00000303148
• Other Databases: GeneCards:  TMEM37  Malacards:  TMEM37

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)