About Us

Search Result


Gene id 140735
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol DYNLL2   Gene   UCSC   Ensembl
Aliases DNCL1B, Dlc2, RSPH22
Gene name dynein light chain LC8-type 2
Alternate names dynein light chain 2, cytoplasmic, 8 kDa dynein light chain b, DLC8b, radial spoke 22 homolog,
Gene location 17q22 (58083418: 58095541)     Exons: 3     NC_000017.11
OMIM 601292

Protein Summary

Protein general information Q96FJ2  

Name: Dynein light chain 2, cytoplasmic (8 kDa dynein light chain b) (DLC8b) (Dynein light chain LC8 type 2)

Length: 89  Mass: 10350

Sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIY
FYLGQVAILLFKSG
Structural information
Interpro:  IPR037177  IPR019763  IPR001372  
Prosite:   PS01239

PDB:  
2XQQ 3P8M 4D07
PDBsum:   2XQQ 3P8M 4D07
MINT:  
STRING:   ENSP00000477310
Other Databases GeneCards:  DYNLL2  Malacards:  DYNLL2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005868 cytoplasmic dynein comple
x
IBA cellular component
GO:0030286 dynein complex
IBA cellular component
GO:0045505 dynein intermediate chain
binding
IBA molecular function
GO:0051959 dynein light intermediate
chain binding
IBA molecular function
GO:2000582 positive regulation of AT
P-dependent microtubule m
otor activity, plus-end-d
irected
IBA biological process
GO:0005813 centrosome
IDA cellular component
GO:0007017 microtubule-based process
IEA biological process
GO:0030286 dynein complex
IEA cellular component
GO:0005875 microtubule associated co
mplex
IEA cellular component
GO:0030286 dynein complex
IEA cellular component
GO:0003774 motor activity
IEA molecular function
GO:0005874 microtubule
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005929 cilium
TAS cellular component
GO:0005929 cilium
TAS cellular component
GO:0005929 cilium
TAS cellular component
GO:0005929 cilium
TAS cellular component
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
TAS biological process
GO:0016236 macroautophagy
TAS biological process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
TAS biological process
GO:0035735 intraciliary transport in
volved in cilium assembly
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0097542 ciliary tip
TAS cellular component
GO:0097542 ciliary tip
TAS cellular component
GO:0097542 ciliary tip
TAS cellular component
GO:0097542 ciliary tip
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0098978 glutamatergic synapse
IEA cellular component
GO:0005868 cytoplasmic dynein comple
x
IEA cellular component
GO:0031475 myosin V complex
IEA cellular component
GO:0005868 cytoplasmic dynein comple
x
IEA cellular component
GO:0097110 scaffold protein binding
IEA molecular function
GO:0044877 protein-containing comple
x binding
IEA molecular function
GO:0042802 identical protein binding
IEA molecular function
GO:0014069 postsynaptic density
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0097731 9+0 non-motile cilium
IDA cellular component
GO:0005634 nucleus
HDA cellular component
GO:0016020 membrane
HDA cellular component
GO:0031475 myosin V complex
ISS cellular component
GO:0098794 postsynapse
IMP cellular component
GO:0098794 postsynapse
IDA cellular component
GO:0098978 glutamatergic synapse
IMP cellular component
GO:0098978 glutamatergic synapse
IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05132Salmonella infection
hsa04962Vasopressin-regulated water reabsorption
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract