• Gene id: 140707

Gene Summary

• Gene Symbol: BRI3BP   Gene   UCSC   Ensembl
• Aliases: BNAS1, HCCR-1, HCCR-2, HCCRBP-1, HCCRBP-3, KG19
• Gene name: BRI3 binding protein
• Alternate names: BRI3-binding protein, I3-binding protein, cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein,
• Gene location: 12q24.31 (124993644: 125051844)     Exons: 4     NC_000012.12
• OMIM: 609667

Protein Summary

• Protein general information: Q8WY22  
  • Name: BRI3 binding protein (I3 binding protein) (Cervical cancer 1 proto oncogene binding protein KG19) (HCCRBP 1)
  • Length: 251  
  • Mass: 27836
  • Tissue specificity: Most abundantly expressed in brain, liver and kidney (PubMed
• Sequence:

  MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQKFLAR
  LTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVL
  HVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLE
  HLEKQVRLLNIRLNRVLESLDRSKDK

• Structural information:
  • Interpro: IPR033367  
  • STRING: ENSP00000340761
• Other Databases: GeneCards:  BRI3BP  Malacards:  BRI3BP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881