• Gene id: 140683

Gene Summary

• Gene Symbol: BPIFA2   Gene   UCSC   Ensembl
• Aliases: C20orf70, PSP, SPLUNC2, bA49G10.1
• Gene name: BPI fold containing family A member 2
• Alternate names: BPI fold-containing family A member 2, parotid secretory protein, short palate, lung and nasal epithelium carcinoma-associated protein 2,
• Gene location: 20q11.21 (33161769: 33181411)     Exons: 27     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the palate, lung and nasal epithelium clone (Plunc) family of proteins. Members of this family have been proposed to play a role in the local antibacterial response in nose, mouth and upper respiratory pathways. The encoded s

Protein Summary

• Protein general information: Q96DR5  
  • Name: BPI fold containing family A member 2 (Parotid secretory protein) (PSP) (Short palate, lung and nasal epithelium carcinoma associated protein 2)
  • Length: 249  
  • Mass: 27011
  • Tissue specificity: Detected in submandibular gland. Secreted into saliva. {ECO
• Sequence:

  MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAK
  QKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASL
  DLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIH
  SLDVNVIQQVVDNPQHKTQLQTLI

• Structural information:
  • Interpro: IPR017943  IPR017942  
  • STRING: ENSP00000253362
• Other Databases: GeneCards:  BPIFA2  Malacards:  BPIFA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide binding	IBA	molecular function
GO:0030141	secretory granule	IBA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R