Male Infertility Database

Search Result

Gene id

140625

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

ACTRT2 Gene UCSC Ensembl

Aliases

ARPM2, ARPT2, Arp-T2, HARPM2

Gene name

actin related protein T2

Alternate names

actin-related protein T2, actin-related protein M2, actin-related protein hArpM2,

Gene location

1p36.32 (3021481: 3022902) Exons: 1 NC_000001.11

Gene summary(Entrez)

The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against

OMIM

608535

Protein Summary

Protein general information

Q8TDY3

Name: Actin related protein T2 (ARP T2) (Actin related protein M2)

Length: 377 Mass: 41,702

Sequence

MFNPHALDSPAVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPF
ERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFENFGVPAFYLSDQAVLALYASA
CVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVAL
EPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIV
LSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVTAADFKEFGTSVVQRR
CF

Structural information

Interpro:	IPR004000 IPR020902 IPR027666
Prosite:	PS01132
STRING:	ENSP00000367658

Other Databases

GeneCards: ACTRT2 Malacards: ACTRT2

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Obesity	INFBASE: 25293813
Asthenozoospermia	MIK: 25293813
Male factor infertility	MIK: 25293813
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25293813
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
25293813	Asthenozoo spermia, O besity	6 (3 normal spe rmatozoa, Obesi ty-associated a sthenozoospermi a)	Male infertility		Show abstract
24012201	Non obstru ctive azoo spermia	31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
23869807	Non obstru ctive azoo spermia, S ertoli cel l only syn drome	20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All