• Gene id: 140609

Gene Summary

• Gene Symbol: NEK7   Gene   UCSC   Ensembl
• Gene name: NIMA related kinase 7
• Alternate names: serine/threonine-protein kinase Nek7, NIMA (never in mitosis gene a)-related kinase 7, never in mitosis A-related kinase 7, nimA-related protein kinase 7,
• Gene location: 1q31.3 (198156997: 198322419)     Exons: 12     NC_000001.11
• Gene summary(Entrez): NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.[supplied by OMIM, Jul 2002]
• OMIM: 611589

Protein Summary

• Protein general information: Q8TDX7  
  • Name: Serine/threonine protein kinase Nek7 (EC 2.7.11.1) (Never in mitosis A related kinase 7) (NimA related protein kinase 7)
  • Length: 302  
  • Mass: 34551
  • Tissue specificity: Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine. {ECO
• Sequence:

  MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKA
  RADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALE
  HMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCL
  LYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTA
  SS

• Structural information:
  • Protein Domains: (34..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR001245  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2WQM 2WQN 5DE2 6GT1 6NPY
  • PDBsum: 2WQM 2WQN 5DE2 6GT1 6NPY
  • DIP: 50780
  • STRING: ENSP00000356355
• Other Databases: GeneCards:  NEK7  Malacards:  NEK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IDA	biological process
GO:0051225	spindle assembly	TAS	biological process
GO:0007346	regulation of mitotic cell cycle	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq