• Gene id: 140606

Gene Summary

• Gene Symbol: SELENOM   Gene   UCSC   Ensembl
• Aliases: SELM, SEPM
• Gene name: selenoprotein M
• Alternate names: selenoprotein M, selenoprotein SelM,
• Gene location: 22q12.2 (31107567: 31104776)     Exons: 5     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the selenoprotein M/SEP15 family. The exact function of this protein is not known. It is localized in the perinuclear region, is highly expressed in the brain, and may be involved in neurodegenerative disorders.
• OMIM: 610918

Protein Summary

• Protein general information: Q8WWX9  
  • Name: Selenoprotein M (SelM)
  • Length: 145  
  • Mass: 16232
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNLVMKHL
  PGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

• Structural information:
  • Interpro: IPR038219  IPR039992  IPR014912  IPR036249  
  • STRING: ENSP00000384564
• Other Databases: GeneCards:  SELENOM  Malacards:  SELENOM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060612	adipose tissue development	IEA	biological process
GO:0035934	corticosterone secretion	IEA	biological process
GO:0010269	response to selenium ion	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0042445	hormone metabolic process	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq