• Gene id: 140465

Gene Summary

• Gene Symbol: MYL6B   Gene   UCSC   Ensembl
• Aliases: MLC1SA
• Gene name: myosin light chain 6B
• Alternate names: myosin light chain 6B, myosin alkali light chain 1 slow a, myosin light chain 1 slow a, myosin light chain 1, slow-twitch muscle A isoform, myosin, light chain 6B, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6B, alkali, smooth muscle and no,
• Gene location: 12q13.2 (56152586: 56157981)     Exons: 8     NC_000012.12
• Gene summary(Entrez): Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-tw
• OMIM: 613814

Protein Summary

• Protein general information: P14649  
  • Name: Myosin light chain 6B (Myosin light chain 1 slow twitch muscle A isoform) (MLC1sa) (Smooth muscle and nonmuscle myosin light chain alkali 6B)
  • Length: 208  
  • Mass: 22764
• Sequence:

  MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFEL
  FDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGF
  RVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV

• Structural information:
  • Protein Domains: (64..9-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (141..17-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (176..20-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0-)
  • Interpro: IPR011992  IPR002048  
  • Prosite: PS50222
  • CDD: cd00051
  • PDB: 1OE9 1W7I 1W7J
  • PDBsum: 1OE9 1W7I 1W7J
  • STRING: ENSP00000450385
• Other Databases: GeneCards:  MYL6B  Malacards:  MYL6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003774	motor activity	TAS	molecular function
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0006936	muscle contraction	TAS	biological process
GO:0016459	myosin complex	TAS	cellular component
GO:0030049	muscle filament sliding	TAS	biological process
GO:0007519	skeletal muscle tissue development	TAS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0008307	structural constituent of muscle	TAS	molecular function
GO:0005859	muscle myosin complex	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016461	unconventional myosin complex	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04530	Tight junction
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881