• Gene id: 140460

Gene Summary

• Gene Symbol: ASB7   Gene   UCSC   Ensembl
• Gene name: ankyrin repeat and SOCS box containing 7
• Alternate names: ankyrin repeat and SOCS box protein 7, ASB-7,
• Gene location: 15q26.3 (100602549: 100651700)     Exons: 6     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-bin
• OMIM: 615052

Protein Summary

• Protein general information: Q9H672  
  • Name: Ankyrin repeat and SOCS box protein 7 (ASB 7)
  • Length: 318  
  • Mass: 36011
• Sequence:

  MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTV
  KDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKG
  TTPLQLAIIRERSSCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRD
  DVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDE
  LPIAKVMKDYLKHKFDDI

• Structural information:
  • Protein Domains: (265..31-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR037326  IPR001496   IPR036036  
  • Prosite: PS50297 PS50088 PS50225
  • CDD: cd03726
  • DIP: 43701
  • STRING: ENSP00000328327
• Other Databases: GeneCards:  ASB7  Malacards:  ASB7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)