• Gene id: 140458

Gene Summary

• Gene Symbol: ASB5   Gene   UCSC   Ensembl
• Aliases: ASB-5
• Gene name: ankyrin repeat and SOCS box containing 5
• Alternate names: ankyrin repeat and SOCS box protein 5, SOCS box protein ASB-5,
• Gene location: 4q34.2 (176277570: 176213672)     Exons: 11     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins
• OMIM: 607009

Protein Summary

• Protein general information: Q8WWX0  
  • Name: Ankyrin repeat and SOCS box protein 5 (ASB 5)
  • Length: 329  
  • Mass: 36341
• Sequence:

  MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYGVTQGQGSWADRSPLH
  EAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACARTLLEAGANVNAITIDGVTPLFNACSQGSPS
  CAELLLEYGAKAQLESCLPSPTHEAASKGHHECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGA
  DVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
  IRSYIGKPRLHLIPQLQLPTLLKNFLQYR

• Structural information:
  • Protein Domains: (278..32-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR037328  IPR001496   IPR036036  
  • Prosite: PS50297 PS50088 PS50225
  • CDD: cd03724
  • STRING: ENSP00000296525
• Other Databases: GeneCards:  ASB5  Malacards:  ASB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045732	positive regulation of protein catabolic process	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq