• Gene id: 1401

Gene Summary

• Gene Symbol: CRP   Gene   UCSC   Ensembl
• Aliases: PTX1
• Gene name: C-reactive protein
• Alternate names: C-reactive protein, C-reactive protein, pentraxin-related, pentraxin 1,
• Gene location: 1q23.2 (159714588: 159712288)     Exons: 4     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting wi
• OMIM: 123260

Protein Summary

• Protein general information: P02741  
  • Name: C reactive protein [Cleaved into: C reactive protein(1 205)]
  • Length: 224  
  • Mass: 25,039
• Sequence:

  MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATK
  RQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEAS
  IILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

• Structural information:
  • Protein Domains: Pentraxin (23-224)
  • Interpro: IPR013320  IPR030476  IPR001759  
  • Prosite: PS00289 PS51828
  • CDD: cd00152
  • PDB: 1B09 1CRV 1GNH 1LJ7 3L2Y 3PVN 3PVO
  • PDBsum: 1B09 1CRV 1GNH 1LJ7 3L2Y 3PVN 3PVO
  • DIP: 39125
  • STRING: ENSP00000255030
• Other Databases: GeneCards:  CRP  Malacards:  CRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001849	complement component C1q binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006953	acute-phase response	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0008228	opsonization	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010888	negative regulation of lipid storage	IDA	biological process
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0032930	positive regulation of superoxide anion generation	IDA	biological process
GO:0033265	choline binding	TAS	molecular function
GO:0045908	negative regulation of vasodilation	IDA	biological process
GO:0045908	negative regulation of vasodilation	IMP	biological process
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000482	regulation of interleukin-8 secretion	IDA	biological process
GO:0046790	virion binding	IDA	molecular function
GO:0001849	complement component C1q binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0006953	acute-phase response	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0008228	opsonization	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010888	negative regulation of lipid storage	IDA	biological process
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0032930	positive regulation of superoxide anion generation	IDA	biological process
GO:0033265	choline binding	TAS	molecular function
GO:0045908	negative regulation of vasodilation	IDA	biological process
GO:0045908	negative regulation of vasodilation	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000482	regulation of interleukin-8 secretion	IDA	biological process
GO:0046790	virion binding	IDA	molecular function
GO:0001849	complement component C1q binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006953	acute-phase response	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0008228	opsonization	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010888	negative regulation of lipid storage	IDA	biological process
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0032930	positive regulation of superoxide anion generation	IDA	biological process
GO:0033265	choline binding	TAS	molecular function
GO:0045908	negative regulation of vasodilation	IDA	biological process
GO:0045908	negative regulation of vasodilation	IMP	biological process
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0050830	defense response to Gram-positive bacterium	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000482	regulation of interleukin-8 secretion	IDA	biological process
GO:0046790	virion binding	IDA	molecular function

Diseases

Associated diseases	References
Cancer	GAD: 17114654
Cancer (Adenoma)	GAD: 20333461
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 19077918
Cancer (endometrial)	GAD: 18383516
Cancer (esophageal)	GAD: 19801321
Cancer (lung)	GAD: 17114654
Cancer (meningeal)	GAD: 20406964
Cancer (prostate)	GAD: 19267370
Cancer (Squamous cell)	GAD: 19495883
Hypertension	GAD: 19410251
Myocardial Infarction	GAD: 18385179
Aneurysm	GAD: 18829218
Angina pectoris	GAD: 17925606
Apoplexy	GAD: 20184533
Atherosclerosis	GAD: 15380464
Atrial fibrillation	GAD: 18393253
Brain ischemia	GAD: 19262552
Cardiovascular disease	GAD: 15797975
Carotid artery diseases	GAD: 19055599
Cerebral hemorrhage	GAD: 19390179
Coronary heart disease	GAD: 15797975
Thromboembolism	GAD: 15304023
Thrombosis	GAD: 11947917
Brain infarction	GAD: 18436879
Fabry disease	GAD: 18172744
Crohn's disease	GAD: 16344720
Macular degeneration	GAD: 16723442
Choroidal neovascularization	GAD: 18704199
Systemic lupus erythematosus (SLE)	GAD: 18793001
Systemic lupus erythematosus (SLE)	KEGG: H00080
Arthritis	GAD: 17596285
Chronic prostatitis	MIK: 6859561
Insulin resistance	GAD: 20494378
Obesity	GAD: 19101671
Metabolic syndrome	GAD: 18285551
Diabetes	GAD: 12618085
Degenerative arthropathy	GAD: 20511616
Giant cell arteritis	GAD: 19040303
Stroke	GAD: 16051899
Alzheimer's disease	GAD: 19141999
Psychological disorders	GAD: 19433520
Depression	GAD: 19433520
Albuminuria	GAD: 21054877
Kidney diseases	GAD: 19578796
Implantation failure	INFBASE: 26952510
Chronic endometritis	INFBASE: 26952510
Female infertility	INFBASE: 26952510
Premature ovarian insufficiency (POI)	INFBASE: 25647778
Pelvic endometriosis	INFBASE: 9436699
Anovulation	INFBASE: 22344731
Endometriosis	INFBASE: 19232412
Polycystic ovary syndrome (PCOS)	INFBASE: 23116196
Preeclampsia	INFBASE: 19282816
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 22344731
Recurrent pregnancy loss (RPL)	INFBASE: 26952510
Erectile dysfunction	MIK: 22973171
HELLP syndrome	INFBASE: 23905607
Chronic obstructive pulmonary disease (COPD)	GAD: 19096002
Connective tissue diseases	GAD: 19527514
Chronic renal failure	GAD: 21085059
Chronic prostatitis	MIK: 6859561
Erectile dysfunction	MIK: 22973171

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22973171	Erectile dysfunction			65 (37 with erectile dysfunction, 28 healthy controls)	Male infertility
6859561	Chronic prostatitis				Male infertility