• Gene id: 140032

Gene Summary

• Gene Symbol: RPS4Y2   Gene   UCSC   Ensembl
• Aliases: RPS4Y2P
• Gene name: ribosomal protein S4 Y-linked 2
• Alternate names: 40S ribosomal protein S4, Y isoform 2, 40S ribosomal protein S4, Y, ribosomal protein S4, Y-linked 2 pseudogene, small ribosomal subunit protein eS4,
• Gene location: Yq11.223 (20756107: 20781031)     Exons: 7     NC_000024.10
• Gene summary(Entrez): The protein encoded by this gene is a ribosomal protein that is highly similar to RPS4Y1. This gene is located in the male-specific region of the Y chromosome. [provided by RefSeq, Aug 2012]
• OMIM: 609268

Protein Summary

• Protein general information: Q8TD47  
  • Name: 40S ribosomal protein S4, Y isoform 2 (Small ribosomal subunit protein eS4)
  • Length: 263  
  • Mass: 29295
• Sequence:

  MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFLKIDGK
  VRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLVTHDARTIRYP
  DPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANGNSFATRISNI
  FVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG

• Structural information:
  • Protein Domains: (42..10-)
    (/note="S4-RNA-binding")
  • Interpro: IPR032277  IPR005824  IPR041982  IPR014722  IPR000876   IPR013845  IPR038237  IPR013843  IPR018199  IPR002942  
  • Prosite: PS00528 PS50889
  • CDD: cd06087
• Other Databases: GeneCards:  RPS4Y2  Malacards:  RPS4Y2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0022627	cytosolic small ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0019843	rRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq