• Gene id: 1400

Gene Summary

• Gene Symbol: CRMP1   Gene   UCSC   Ensembl
• Aliases: CRMP-1, DPYSL1, DRP-1, DRP1, ULIP-3
• Gene name: collapsin response mediator protein 1
• Alternate names: dihydropyrimidinase-related protein 1, dihydropyrimidinase-like 1, inactive dihydropyrimidinase, unc-33-like phosphoprotein 3,
• Gene location: 4p16.2 (5893085: 5820763)     Exons: 17     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collaps
• OMIM: 616440

Protein Summary

• Protein general information: Q14194  
  • Name: Dihydropyrimidinase related protein 1 (DRP 1) (Collapsin response mediator protein 1) (CRMP 1) (Inactive dihydropyrimidinase) (Unc 33 like phosphoprotein 3) (ULIP 3)
  • Length: 572  
  • Mass: 62184
  • Tissue specificity: Brain.
• Sequence:

  MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTY
  LQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVRE
  ELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHAL
  SRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAA
  FVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKM
  DENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQG
  KIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSK
  HQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

• Structural information:
  • Interpro: IPR006680  IPR030624  IPR011778  IPR011059  IPR032466  
  • CDD: cd01314
  • PDB: 4B3Z
  • PDBsum: 4B3Z
  • STRING: ENSP00000321606
• Other Databases: GeneCards:  CRMP1  Malacards:  CRMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004157	dihydropyrimidinase activity	IBA	NOT|molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006208	pyrimidine nucleobase catabolic process	IBA	NOT|biological process
GO:0016812	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904530	negative regulation of actin filament binding	IDA	biological process
GO:0010977	negative regulation of neuron projection development	IGI	biological process
GO:1904530	negative regulation of actin filament binding	IMP	biological process
GO:0031005	filamin binding	IPI	molecular function
GO:0031005	filamin binding	IEA	molecular function
GO:0048666	neuron development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq